KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_08310Help
Entry
CGSHiEE_08310     CDS       T00543                                 

Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hip00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CGSHiEE_08310
   01230 Biosynthesis of amino acids
    CGSHiEE_08310
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CGSHiEE_08310
  Energy metabolism
   00680 Methane metabolism
    CGSHiEE_08310
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CGSHiEE_08310
Enzymes [BR:hip01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CGSHiEE_08310
Exosome [BR:hip04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CGSHiEE_08310
  Exosomal proteins of melanoma cells
   CGSHiEE_08310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1631179..1631862)
Genome map
AA seq 227 aa AA seqDB search
MELVFIRHGFSEWNAKNLFTGWRDVNLTERGVEEAKAAGKKLLDKGYEFDIAFTSVLTRA
IKTCNIVLEESHQLWIPQVKNWRLNERHYGALQGLDKKATAEQYGDEQVHIWRRSYDISP
PDLDPQDPNSAHNDRRYANIPSDVVPNAENLKLTLERALPFWEDQIAPAMLSGKRVLVVA
HGNSLRALAKHIIGISDAEIMDFEIPTGQPLVLKLDDKLNYVEHYYL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggaattagtatttatccgtcacggttttagtgaatggaatgcgaaaaacttattcaca
ggctggcgtgatgtgaatttaactgaacgtggtgtggaagaagcaaaagctgcgggtaaa
aaactgttagacaaaggttatgaatttgatatcgcatttacctctgttttaactcgagca
atcaaaacttgtaacatcgtgttagaagaatcccatcaattatggattccacaagtaaaa
aactggcgtttaaatgaacgtcattatggtgctttacaaggtttagataaaaaagcgact
gcggagcaatacggtgacgaacaagttcatatttggcgtcgttcttatgacatttctcca
ccagatttagatccacaagatccaaattctgcacacaatgaccgtcgctacgcaaatatt
ccatctgatgttgtgccaaacgcagaaaatttaaaattaacattagaacgcgcattacca
ttctgggaagatcaaattgcaccagcaatgctttctggcaaacgtgttttagtggttgct
cacggaaattcacttcgtgcgttggcaaaacatattatcggtatttctgatgctgaaatt
atggattttgaaattccaacaggtcagcctttagttttaaaacttgatgataaattaaat
tacgtagaacattactatctttaa

DBGET integrated database retrieval system