KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_08705Help
Entry
CGSHiEE_08705     CDS       T00543                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hip00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CGSHiEE_08705 (tpiA)
   01230 Biosynthesis of amino acids
    CGSHiEE_08705 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CGSHiEE_08705 (tpiA)
   00051 Fructose and mannose metabolism
    CGSHiEE_08705 (tpiA)
   00562 Inositol phosphate metabolism
    CGSHiEE_08705 (tpiA)
Enzymes [BR:hip01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CGSHiEE_08705 (tpiA)
Exosome [BR:hip04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CGSHiEE_08705 (tpiA)
  Exosomal proteins of bladder cancer cells
   CGSHiEE_08705 (tpiA)
  Exosomal proteins of melanoma cells
   CGSHiEE_08705 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1722172..1722963)
Genome map
AA seq 263 aa AA seqDB search
MARRPLVMGNWKLNGSKAFTKELIEGLKAELHDVTGCDVAIAPPVMYLGTAEAALSGCGC
NCGGKSVIQLGAQNVDINVKGAFTGDISTEMLKDFGAKYIIIGHSERRTYHKESDEFVAK
KFGALKEAGLVPVLCIGESEAENEAGKTEEVCARQIDAVINALGVEAFNGAVIAYEPIWA
IGTGKSATPAQAQAVHAFIRGHIAAKSQAVAEQVIIQYGGSVNDANAAELFTQPDIDGAL
VGGASLKAPAFAVIVKAAAAAKN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtcgtcctttagttatgggtaactggaaattaaacggtagcaaagcattcacg
aaagaattaatcgagggattaaaagcggaattacatgatgtaacaggttgtgatgtagca
attgcccctcccgttatgtatttaggtacggctgaagctgcactttctggttgtggttgc
aactgtggcggtaaaagtgtgattcaattaggtgcacaaaacgtagatatcaatgtgaaa
ggtgcatttactggtgatatttcaactgaaatgttaaaagatttcggtgcaaaatatatc
attattggccactctgaacgccgcacttatcataaagaaagcgacgaatttgtggcgaaa
aaatttggtgcattaaaagaagctggtttagtgccagtattatgtattggtgaatctgaa
gcagaaaatgaagcaggcaaaactgaagaagtatgtgcacgtcaaattgatgcagtcatc
aatgcattaggcgtagaagcattcaacggtgcagtgatcgcatacgaaccaatctgggcg
attggcacgggtaaatctgcgactccagcacaagcacaagcagttcacgcatttatccgc
ggtcacatcgcggcgaaatcacaagccgtggcagagcaagtaattattcaatacggcggt
tctgtaaatgatgcaaatgccgctgaattatttactcagccagacattgatggcgcatta
gtgggtggcgcatcattaaaagcccctgcatttgcagtaattgttaaagcagcagctgca
gcgaaaaactaa

DBGET integrated database retrieval system