KEGG   Haemophilus influenzae PittGG (nontypeable): CGSHiGG_00440Help
Entry
CGSHiGG_00440     CDS       T00544                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
hiq  Haemophilus influenzae PittGG (nontypeable)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:hiq00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CGSHiGG_00440
Enzymes [BR:hiq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CGSHiGG_00440
Exosome [BR:hiq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CGSHiGG_00440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
76372..78564
Genome map
AA seq 730 aa AA seqDB search
MTTAVTQAIIDGFFDASNGDPFATLGMHETEQGIEIRTLLPDANRMVVIERESGKEITEL
DCVDERGFFVGVIPNCRQFFAYQLQVFWGNEAQIIEDPYRFHPMIDDLEQWLLSEGSMLR
PYEVLGAHFMECDGVSGVNFRLWAPNARRVSIVGDFNYWDGRRHPMRFHSKSGVWELFLP
KASLGQLYKFELIDCHGNLRLKADPFAFSSQLRPDTASQVSALPNVVEMTEARKKANQGN
QPISIYEVHLGSWRRNLENNFWLDYDQIADELIPYVKEMGFTHIEFLPLSEFPFDGSWGY
QPLGLYSPTSRFGSPEAFSRLVKRAHEAGINVILDWVPGHFPSDTHGLVAFDGTALYEHE
DPREGYHQDWNTLIYNYGRNEVKNFLSSNALYWLERFGVDGIRVDAVASMIYRDYSRVEG
EWIPNQYGGRENLEAIEFLKHTNWKIHSEMAGAISIAEESTSFAGVTHPSENGGLGFNFK
WNMGWMNDTLAYMKLDPIYRQYHHNKMTFGMVYQYSENFVLPLSHDEVVHGKYSLLGKMP
GDTWQKFANLRAYYGYMWGYPGKKLLFMGNEFAQGREWNHEESLDWFLLDENIDGGWHKG
VLKLVKDLNQIYQKNRPLFELDNSPEGFDWLVVDDAANSVFAFERRSSNGERIIVVSNFT
PVPRHDYRIGVNIVGEYEEILNTDSMYYQGSNVGNFGCVASENIESHGRENSISVSIPPL
ATVYLRLKAK
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccgcagtaacacaagcaattattgatggtttttttgatgcgagcaatggtgat
ccttttgctacgcttggtatgcacgaaaccgagcaaggaattgaaatccgtacgttattg
ccagatgccaatcgaatggtggtgattgagcgtgaaagtggtaaagaaataacggaactg
gattgtgtcgatgagcgtggattttttgttggtgttattccaaattgtcgtcaatttttt
gcttatcaattacaggttttttggggtaatgaagcacaaattatcgaagatccttatcgt
tttcatccaatgattgacgatttagaacaatggctactttctgaaggatctatgcttcgc
ccctatgaagtgcttggtgcgcattttatggaatgtgatggtgtgagcggggtgaatttc
cgcttgtgggcacctaatgcaagacgagtttctattgtaggtgatttcaactattgggat
ggtcgtcgccacccgatgcgtttccactcgaaaagtggtgtttgggagctctttttacca
aaagccagtttaggacagctctataagtttgaattaattgattgccatggcaatcttcgt
ttgaaggccgatccatttgcctttagttcgcaacttcgccctgatacagcttcgcaagtc
agtgccttgccaaatgtagtggaaatgactgaagcacgcaaaaaagcaaaccaaggcaac
caaccaatttctatttatgaagtgcatttaggatcttggcgtcgtaatttagaaaacaat
ttttggctagattacgatcaaattgctgatgaattaattccttatgtaaaagagatgggc
ttcacccatatagaatttttaccgctttcggaatttccatttgatggttcttggggctat
caaccacttggactttattcgccaaccagtcgttttggctcacctgaggcatttagccgt
ttagtaaaacgtgctcacgaagcaggcatcaacgtgattttagattgggtgccaggacat
ttcccaagtgatacgcatggtttagttgcatttgatggcacagccttgtatgaacatgaa
gaccctcgtgaaggctatcatcaagattggaataccttgatttataactatgggcgtaat
gaggtcaaaaatttcttatccagtaatgcactgtattggcttgaacgttttggcgtagat
ggtattcgcgtggatgctgtggcttccatgatttaccgtgattatagccgtgtggagggc
gagtggattccaaaccaatacggcggacgtgaaaatttagaagccatcgagtttttaaaa
cacaccaactggaaaattcacagtgaaatggcgggtgcaatttctattgcggaagaatca
acttcttttgcaggcgtaacccacccaagcgaaaacggcggcttgggcttcaatttcaaa
tggaatatgggctggatgaacgatacactggcttatatgaagcttgaccccatttaccgc
caatatcatcacaacaaaatgacctttggaatggtgtatcaatatagcgaaaattttgtg
ctaccactttctcacgatgaagtggttcacggtaaatattcacttcttggcaagatgccg
ggcgatacatggcaaaaattcgctaacttgcgtgcatattacggttatatgtggggctac
ccaggcaaaaaattactctttatggggaatgaatttgctcaaggcagagaatggaatcac
gaagaaagtttggactggttcttgcttgatgaaaatattgacggaggctggcacaaaggc
gtattgaagctggtgaaagatctcaatcaaatttatcaaaaaaatcgaccgctctttgag
ctcgacaactccccagagggtttcgattggcttgtcgttgatgatgcggcaaattctgtg
ttcgcctttgaacgtcgcagttcaaacggagaacgtattattgtcgtcagtaactttacc
cctgtgcctcgccacgactaccgcatcggcgtgaatattgtgggcgaatatgaagaaatt
ttgaataccgattcaatgtactatcaaggctctaacgtgggcaattttggttgtgtcgca
agtgaaaatatcgaaagccacggacgagaaaattcgatttcagtgtccattccaccgtta
gcaacagtttatttgagattgaaggcgaaataa

DBGET integrated database retrieval system