KEGG   Haemophilus influenzae PittGG (nontypeable): CGSHiGG_00750Help
Entry
CGSHiGG_00750     CDS       T00544                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
hiq  Haemophilus influenzae PittGG (nontypeable)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:hiq00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CGSHiGG_00750
   00240 Pyrimidine metabolism
    CGSHiGG_00750
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CGSHiGG_00750
   03430 Mismatch repair
    CGSHiGG_00750
   03440 Homologous recombination
    CGSHiGG_00750
Enzymes [BR:hiq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     CGSHiGG_00750
DNA replication proteins [BR:hiq03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     CGSHiGG_00750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(141487..141921)
Genome map
AA seq 144 aa AA seqDB search
MAKTAQFYILTENCTLTVEEIACNLVASIWRSGKKVLISCESESQALEIDELLWQRDPNE
FVPHNLSGEATQYPTPIEISWLGKRNLQRRDMLINLQQEIPDFSHSFTQIIDFVPKDDAL
KTQARERYKQLRLQGWNLSTENVG
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaactgcacaattttatattcttacggaaaattgtactttaactgtcgaagaa
atagcctgtaatcttgttgcttcaatatggcgttcagggaaaaaagtactaattagttgc
gaaagtgagagccaagcattagaaattgatgaacttttgtggcaacgagatcctaatgaa
tttgttccgcataatttatcgggtgaggcaacacaatatcccacaccgattgagatttca
tggcttggaaaacgaaatttacaacgccgcgatatgttaattaatttgcaacaagaaatc
ccagattttagccatagttttacccaaattattgattttgtgccgaaagatgatgcgtta
aaaacacaagctcgagaacgttataaacaattacgtctgcaaggttggaatctttctact
gaaaacgtgggttaa

DBGET integrated database retrieval system