KEGG   Haemophilus influenzae PittGG (nontypeable): CGSHiGG_01025Help
Entry
CGSHiGG_01025     CDS       T00544                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hiq  Haemophilus influenzae PittGG (nontypeable)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hiq01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:hiq00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:hiq00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
177199..178395
Genome map
AA seq 398 aa AA seqDB search
MSDTLLNPYFGEFGGMYVPEILVPVLKQLEQAFVEAQNDPTFQAEFADLLKNYAGRPTAL
TLCRNLTKGTKTKLYLKREDLLHGGAHKTNQVLGQILLAKRMGKTRIIAETGAGQHGVAT
ALACAMLDMPCRVYMGAKDVERQSPNVFRMRLMGAEVIPVQKGSCSLKDACCEAMRDWSA
NYETTHYLLGTAAGPHPFPTIVREFQKMIGEETKRQILEREGRLPDAVIAAVGGGSNAIG
MFADFIDESNVRLIGVEPAGKGIETGEHGAPLKHGTTGIYFGMKSPIMQDKDGQIEESYS
ISAGLDFPSVGPQHAYLNEIGRAEYVSITDEEALNAFQELAKHEGIIPALESSHALAYAL
KLIKQNPEKEQLLVVNLSGRGDKDIFTVDKILTEKGMK
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacacacttcttaacccttattttggcgaatttggcggaatgtatgtacccgaa
attttagtgcctgttttaaagcaattagaacaagcctttgtggaggctcaaaatgatcct
acattccaagcagaatttgctgatttactcaaaaattatgcgggcagaccgaccgcactt
actctttgtcgtaacttaactaaaggtacaaaaactaaactttatcttaaacgtgaagat
ttattacacggtggtgcacacaaaaccaaccaggtgttagggcaaattttattggctaaa
cgtatgggcaaaacgcgtattattgccgaaacaggtgcgggtcagcacggtgttgcgacc
gccctagcttgtgctatgttagatatgccgtgtcgtgtttatatgggtgcaaaagatgtt
gagcgtcaatcaccaaacgtgttccgtatgcgtttaatgggggctgaagtaattcctgta
caaaaaggctcttgttctttaaaagatgcctgttgtgaagcgatgcgtgattggtcagca
aattatgaaaccacccattatttacttggaaccgctgcaggccctcaccctttcccgacg
attgtgagagaatttcaaaaaatgattggcgaagaaaccaaacgtcaaattctcgaacgg
gaaggtcgtttacctgatgcagtcattgctgctgttggcggtggctcgaatgcaattggt
atgtttgctgattttattgatgaatcaaatgtgcgtttaattggtgttgagcctgcgggt
aaaggtattgaaacgggcgaacacggtgcaccgctcaagcacggcacaacaggcatctac
ttcggaatgaaatcgccaattatgcaagataaagatggacaaattgaggaatcctattcc
atttctgcagggttagattttccctctgtcgggccgcaacatgcttatttaaatgagatt
ggtcgtgctgagtatgtatcgattaccgatgaagaagccctcaacgcattccaagaattg
gcaaaacatgaaggcattatccctgcattagaaagctcacacgccttggcttatgccttg
aaattgattaaacaaaatcctgaaaaagaacaacttttagtggttaatctttcgggacga
ggcgataaagatatttttaccgttgataaaattttgacagaaaaaggaatgaaataa

DBGET integrated database retrieval system