KEGG   Haemophilus influenzae PittGG (nontypeable): CGSHiGG_01030Help
Entry
CGSHiGG_01030     CDS       T00544                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hiq  Haemophilus influenzae PittGG (nontypeable)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hiq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CGSHiGG_01030 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CGSHiGG_01030 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CGSHiGG_01030 (trpA)
Enzymes [BR:hiq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CGSHiGG_01030 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
178395..179201
Genome map
AA seq 268 aa AA seqDB search
MSRFETQFATLNAKNEGAFVPFVTLCDPTFDRSFEIICTLVDNGADALELGFPFSDPLLD
GPVIQAANNRALTAGHSSEDSFKLLEKVRSKYPEIPISLLLCANLIFAKGLDAFYQRCAE
VGVDAVLVADIPLLAKEDYVQAAKKHGIQPVFICPPNADEKTIQGVAENSEGYTYLVSRA
GVTSAENQAHAANLDTLVEQLKAHNAPPILQGFGIAQPEQVKEALSLGTAGAISGSATVK
IIERNLDNHEQCLAELAEFVQTMKAATK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagccgttttgaaacgcaatttgcgacacttaacgcaaaaaatgaaggggctttcgtg
ccgttcgttaccctttgcgaccctactttcgaccgctcttttgagatcatttgcacactt
gtggataacggtgcagatgctttagaactcggttttcctttttccgatccgctactcgat
ggcccagttattcaagccgcgaataatcgtgctttaactgcgggtcatagcagtgaagat
agctttaaactattggaaaaagtgcggtcaaaatatcccgagattccgattagcttatta
ctttgtgccaatttaatttttgctaaaggtttagatgctttttatcaacgttgtgcagaa
gtcggggttgatgctgtgcttgtggcagatattccgttactcgcaaaagaagattatgta
caagcggctaaaaaacacggcattcaacccgtctttatttgcccgccaaatgcggacgag
aaaacgatccaaggcgtagcggaaaatagcgaaggctatacctatttagtttcccgtgct
ggcgtaaccagtgcagaaaatcaagcccacgcagcaaatttggatacccttgtagaacag
cttaaggcacataatgccccaccaattttacaaggcttcggcattgctcaaccagagcaa
gttaaagaagcgttgtctttgggcactgcgggtgcaatttcaggttcggcaacggtgaaa
attattgagcgaaatttagataatcacgagcaatgtttagctgaattagctgaatttgtt
caaacaatgaaagctgcaacaaaataa

DBGET integrated database retrieval system