KEGG   Haemophilus influenzae PittGG (nontypeable): CGSHiGG_01215Help
Entry
CGSHiGG_01215     CDS       T00544                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hiq  Haemophilus influenzae PittGG (nontypeable)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hiq00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(204260..205087)
Genome map
AA seq 275 aa AA seqDB search
MKLYANNKCLDLSVPQIMGILNFTPDSFSDSGQFFSLDKALFQVEKMLEEGATIIDIGGE
STRPNADEVSEQEELHRVLPVVEAVRNRFDCWISVDSSKAIVMREAANVGMDLINDIRAL
QEPNALETAVKLALPVCIMHMQGQPRTMQANPYYENVVQDVLAFLQKRTNECLSAGIKKE
NLIWDMGFGFGKSVQHNYQLLQNLNEFCLNGYPVLAGLSRKSMIGAVLEKPIDQRVIGSA
AGALIAVQKGAKILRVHDVAATSDMLKVWQATANA
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaaactttacgcaaataataaatgtcttgatttaagcgtgcctcaaattatggggatt
cttaattttacgcctgattctttttctgatagcggacagttttttagtctagataaagca
ctttttcaagttgaaaaaatgctagaagagggggcgacaattattgatattggtggagaa
tccactcgtccgaatgcggatgaagtttctgaacaagaggaattgcatcgtgttttacca
gtagtggaggcggtgcgaaaccgttttgattgctggatttctgttgattcctcaaaagca
attgtgatgcgtgaagcggcaaatgttggaatggatttgattaatgatattcgtgctttg
caagagccgaatgcgttagaaacggcggtaaaactggctttacctgtttgtattatgcat
atgcaagggcaacctcgcacgatgcaagcaaatccttattatgaaaatgtcgtgcaagat
gtattggcttttttacaaaaacgtactaatgaatgcctttctgctggcattaaaaaagaa
aatttaatttgggatatgggctttggctttggcaaatctgtacagcataattatcaatta
ttacaaaatctgaatgaattttgtctgaatggttatcccgtattagcaggattatctcgc
aaatcaatgattggcgcagtgcttgagaaacccatcgatcagcgagtgattggcagtgcg
gcaggtgcgcttattgcagtgcaaaaaggtgcaaaaattttacgcgtacatgatgttgct
gcaacatcagatatgctcaaagtttggcaggcaacagcaaatgcctga

DBGET integrated database retrieval system