KEGG   Haemophilus influenzae PittGG (nontypeable): CGSHiGG_01280Help
Entry
CGSHiGG_01280     CDS       T00544                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
hiq  Haemophilus influenzae PittGG (nontypeable)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hiq00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CGSHiGG_01280
Enzymes [BR:hiq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CGSHiGG_01280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(215305..217227)
Genome map
AA seq 640 aa AA seqDB search
MLSVLHKLKEQRILSQGDYYFAKLIADKQCHMDYAEPIKNLAILLAALCSWRYTQGNTCS
QLDRYLEHNLFGLAYRTTEEDYLAEIHEKIGYLPVEDWQNALHGHMAFTQDPVNQIAPMA
FQFGALYFYRTWQDEYRIAQYIKNTLKKHRTLAFSYDEIHQKLEKFFPEKQEKTDWQKVA
VATAIKSPFSIITGGPGTGKTTTVTRLLLALQELFDCKLHIKLVAPTGKAASRLEESIKN
ALGFMQEKMNLSDSLFNAIPQKASTLHSLLGVNAFNDYTRYNSHNPLQLDVLVVDETSMI
DLPMMAKLINALKPETRLILLGDQAQLASVEAGAVLGELAQFVNQPYSHEQASYLQATTG
YKVEGSDCSNPIRDCLCHLTESRRFDKDSGIGKLSEFIQKGKADDSLKLFEHYPQELHFN
ALNDESDAVNQVVKSAVENYRTFLKMLDDLRKQKIDPNAKNEQGISYAEAIQAQFNSVRF
LTALRNNNLGVENLNKEIALALREQKLLWFRNEQDWYIGKPIMITENDHNVRLYNGDIGL
CLANGKVWFGNREVLTNRIPAHEPAFMMTIHKSQGSEFEHTVMVLPTEVNPVLSRELVFT
GVTRAKKELTVFADEKIWKTAIRQTVKRQSGLGKLLEDLN
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgttatctgtattacacaaacttaaagagcagcgcattctttctcaaggtgattattat
tttgctaagttgatagctgataaacaatgtcatatggattatgcggaaccaatcaaaaat
ttagccatattattagccgcactttgtagttggcgttatacgcagggaaatacttgcagc
caattagatcgctatttagaacataatttatttggtttggcttatcgtacaacagaagaa
gattatttagctgaaattcatgaaaagattggttatttacccgttgaagattggcaaaat
gcgttgcacgggcatatggcatttacgcaagatcccgtcaatcaaattgcaccaatggca
tttcaatttggcgcgttgtatttctatcgcacttggcaagatgaatatcgtatcgcacaa
tatataaaaaacactttaaaaaaacaccgcactttagccttttcttatgatgaaattcat
caaaaattagagaaatttttccctgaaaaacaggaaaaaacagattggcaaaaagtggca
gtggcgacagcgattaaaagtccattttcgattattacaggcggccctggaacaggaaaa
accacgacagttacgcgtttattgctcgctctacaagaattatttgattgtaaattacac
atcaaattggttgcgccgactggcaaagccgcctctcgtttggaagagtcgattaaaaat
gcgttaggttttatgcaagaaaaaatgaatttatccgattcacttttcaatgcgattcca
caaaaagccagcactttgcatagtttactgggtgtgaatgcctttaatgattacacgcgc
tataacagccataaccctttgcaattagatgtgttagttgttgatgaaacatcaatgatt
gatttaccgatgatggcaaaacttatcaatgcgttaaagcccgaaacccgattaatttta
ttaggcgatcaggcgcaattagcctctgttgaggcgggggctgtattgggggaattggct
caatttgttaatcaaccttatagtcatgaacaagcctcatatttgcaagcgacaacaggc
tacaaagtagaaggttccgattgttcaaatccaatacgtgattgcttatgccatctaaca
gaaagtcgccgttttgataaagattcaggcattggcaagttgtccgaattcattcaaaaa
ggcaaagcagacgatagccttaagttatttgaacattatccgcaagaattgcactttaat
gccctaaatgatgaaagcgatgcggtcaatcaagtggtgaaaagtgcggtggaaaattac
cgcactttcttaaaaatgttggacgatttacgtaaacaaaaaattgatcctaacgctaaa
aatgaacaaggcatttcctatgccgaagccattcaagcgcaatttaattctgtgagattt
ttaaccgcacttcgtaataacaatttaggtgtcgaaaatctcaataaagaaattgcgtta
gcgttgcgagagcaaaaattgctttggttccgtaatgaacaagattggtatatcggcaag
ccaattatgattactgaaaacgatcataacgttcgcctttataacggcgatattggacta
tgcttggcaaatggcaaagtatggtttggcaatcgagaagtgctgacaaaccgaattcca
gcgcacgaacccgcttttatgatgacgattcataaatctcaaggttccgaatttgaacat
accgtcatggtgcttccaacagaagtaaatccagtactgtcgcgagaattagttttcacg
ggcgtcactcgtgcgaaaaaagaactcactgtatttgccgatgaaaaaatatggaaaaca
gcgattcgtcagaccgtcaaacgccagagcggattgggaaaattattggaagatttaaat
tag

DBGET integrated database retrieval system