KEGG   Haemophilus influenzae PittGG (nontypeable): CGSHiGG_01280Help
Entry
CGSHiGG_01280     CDS       T00544                                 

Definition
(GenBank) exodeoxyribonuclease V alpha chain
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
hiq  Haemophilus influenzae PittGG (nontypeable)
Pathway
hiq03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:hiq00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CGSHiGG_01280
Enzymes [BR:hiq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CGSHiGG_01280
DNA repair and recombination proteins [BR:hiq03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CGSHiGG_01280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Helicase_RecD Viral_helicase1 AAA_11 DUF2075 UvrD-helicase AAA_22 UvrD_C AAA_16 AAA_28 KBP_C PhoH AAA_18 T2SSE NTPase_1 ResIII FtsK_SpoIIIE CbiA
Motif
Other DBs
NCBI-ProteinID: ABQ99345
UniProt: A5UEZ0
Position
complement(215305..217227)
Genome map
AA seq 640 aa AA seqDB search
MLSVLHKLKEQRILSQGDYYFAKLIADKQCHMDYAEPIKNLAILLAALCSWRYTQGNTCS
QLDRYLEHNLFGLAYRTTEEDYLAEIHEKIGYLPVEDWQNALHGHMAFTQDPVNQIAPMA
FQFGALYFYRTWQDEYRIAQYIKNTLKKHRTLAFSYDEIHQKLEKFFPEKQEKTDWQKVA
VATAIKSPFSIITGGPGTGKTTTVTRLLLALQELFDCKLHIKLVAPTGKAASRLEESIKN
ALGFMQEKMNLSDSLFNAIPQKASTLHSLLGVNAFNDYTRYNSHNPLQLDVLVVDETSMI
DLPMMAKLINALKPETRLILLGDQAQLASVEAGAVLGELAQFVNQPYSHEQASYLQATTG
YKVEGSDCSNPIRDCLCHLTESRRFDKDSGIGKLSEFIQKGKADDSLKLFEHYPQELHFN
ALNDESDAVNQVVKSAVENYRTFLKMLDDLRKQKIDPNAKNEQGISYAEAIQAQFNSVRF
LTALRNNNLGVENLNKEIALALREQKLLWFRNEQDWYIGKPIMITENDHNVRLYNGDIGL
CLANGKVWFGNREVLTNRIPAHEPAFMMTIHKSQGSEFEHTVMVLPTEVNPVLSRELVFT
GVTRAKKELTVFADEKIWKTAIRQTVKRQSGLGKLLEDLN
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgttatctgtattacacaaacttaaagagcagcgcattctttctcaaggtgattattat
tttgctaagttgatagctgataaacaatgtcatatggattatgcggaaccaatcaaaaat
ttagccatattattagccgcactttgtagttggcgttatacgcagggaaatacttgcagc
caattagatcgctatttagaacataatttatttggtttggcttatcgtacaacagaagaa
gattatttagctgaaattcatgaaaagattggttatttacccgttgaagattggcaaaat
gcgttgcacgggcatatggcatttacgcaagatcccgtcaatcaaattgcaccaatggca
tttcaatttggcgcgttgtatttctatcgcacttggcaagatgaatatcgtatcgcacaa
tatataaaaaacactttaaaaaaacaccgcactttagccttttcttatgatgaaattcat
caaaaattagagaaatttttccctgaaaaacaggaaaaaacagattggcaaaaagtggca
gtggcgacagcgattaaaagtccattttcgattattacaggcggccctggaacaggaaaa
accacgacagttacgcgtttattgctcgctctacaagaattatttgattgtaaattacac
atcaaattggttgcgccgactggcaaagccgcctctcgtttggaagagtcgattaaaaat
gcgttaggttttatgcaagaaaaaatgaatttatccgattcacttttcaatgcgattcca
caaaaagccagcactttgcatagtttactgggtgtgaatgcctttaatgattacacgcgc
tataacagccataaccctttgcaattagatgtgttagttgttgatgaaacatcaatgatt
gatttaccgatgatggcaaaacttatcaatgcgttaaagcccgaaacccgattaatttta
ttaggcgatcaggcgcaattagcctctgttgaggcgggggctgtattgggggaattggct
caatttgttaatcaaccttatagtcatgaacaagcctcatatttgcaagcgacaacaggc
tacaaagtagaaggttccgattgttcaaatccaatacgtgattgcttatgccatctaaca
gaaagtcgccgttttgataaagattcaggcattggcaagttgtccgaattcattcaaaaa
ggcaaagcagacgatagccttaagttatttgaacattatccgcaagaattgcactttaat
gccctaaatgatgaaagcgatgcggtcaatcaagtggtgaaaagtgcggtggaaaattac
cgcactttcttaaaaatgttggacgatttacgtaaacaaaaaattgatcctaacgctaaa
aatgaacaaggcatttcctatgccgaagccattcaagcgcaatttaattctgtgagattt
ttaaccgcacttcgtaataacaatttaggtgtcgaaaatctcaataaagaaattgcgtta
gcgttgcgagagcaaaaattgctttggttccgtaatgaacaagattggtatatcggcaag
ccaattatgattactgaaaacgatcataacgttcgcctttataacggcgatattggacta
tgcttggcaaatggcaaagtatggtttggcaatcgagaagtgctgacaaaccgaattcca
gcgcacgaacccgcttttatgatgacgattcataaatctcaaggttccgaatttgaacat
accgtcatggtgcttccaacagaagtaaatccagtactgtcgcgagaattagttttcacg
ggcgtcactcgtgcgaaaaaagaactcactgtatttgccgatgaaaaaatatggaaaaca
gcgattcgtcagaccgtcaaacgccagagcggattgggaaaattattggaagatttaaat
tag

DBGET integrated database retrieval system