KEGG   Haemophilus influenzae PittGG (nontypeable): CGSHiGG_01310Help
Entry
CGSHiGG_01310     CDS       T00544                                 

Definition
(GenBank) predicted enzyme
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
hiq  Haemophilus influenzae PittGG (nontypeable)
Pathway
hiq00010  Glycolysis / Gluconeogenesis
hiq01100  Metabolic pathways
hiq01110  Biosynthesis of secondary metabolites
hiq01120  Microbial metabolism in diverse environments
hiq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hiq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CGSHiGG_01310
Enzymes [BR:hiq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     CGSHiGG_01310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ABQ99349
UniProt: A5UEZ4
Structure
PDB: 

Jmol
Position
complement(222482..223294)
Genome map
AA seq 270 aa AA seqDB search
MKTTLLKTLTPELNLVQHNDIPVLHLKHAVGTAKISLQGVQLISWKPQNAKQDVLWLSEV
EPFKNGNAIRGGVPICYPWFGGVKQPAHGTARIRLWQLSHYDISAHKVRLEFELFSDLNI
IEAKVSMVFTDKCHLTFTHYGEEPAQAALHTYFNIGDINQVEVQGLPETCFNSLNQQQEN
VPSPRHISENVDCIYSAENMQNQIVDKSFNRTIALHHHNASQFVLWNPWHKKTSGMSETG
YQTMLCLETARIHHLLEFGESLSVEISLKG
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaacattactaaaaacactgacaccagagcttaatcttgttcaacataacgac
attccagttcttcacttaaaacatgcggttggaacagcaaaaatttccctgcaaggggta
cagcttatcagttggaaaccgcaaaatgcgaagcaagatgtattatggctaagtgaagta
gagccattcaaaaatggcaatgctattcgtggtggcgtaccgatttgctatccttggttt
ggtggcgtaaaacaacctgcgcacggtacagctcgtattcgtttatggcagttaagccat
tatgatatttcagcccataaagtgcggttagaatttgagttgttttctgatttgaatatt
atcgaagctaaagtctcaatggtatttacagataaatgtcatttaacttttacccattat
ggcgaagaaccagcccaagcagcattacatacctattttaatattggggatattaatcaa
gtggaagtacaaggtttacctgaaacttgttttaatagcttaaaccaacaacaagaaaat
gttccgtcaccgcgtcacatttctgaaaatgttgattgcatttattctgcagaaaacatg
cagaatcaaatcgtagataaaagtttcaatcgtacgattgcactgcatcatcataatgca
agtcaatttgttctttggaatccttggcacaaaaagacgagtggaatgagtgaaactggc
tatcaaacgatgttgtgcttagaaactgcacgtatccatcacttgcttgaatttggcgaa
agtttaagcgtggaaatttcgcttaaaggctaa

DBGET integrated database retrieval system