KEGG   Haemophilus influenzae PittGG (nontypeable): CGSHiGG_01845Help
Entry
CGSHiGG_01845     CDS       T00544                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hiq  Haemophilus influenzae PittGG (nontypeable)
Pathway
hiq00010  Glycolysis / Gluconeogenesis
hiq00020  Citrate cycle (TCA cycle)
hiq00620  Pyruvate metabolism
hiq01100  Metabolic pathways
hiq01110  Biosynthesis of secondary metabolites
hiq01120  Microbial metabolism in diverse environments
hiq01130  Biosynthesis of antibiotics
hiq01200  Carbon metabolism
Module
hiq_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hiq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CGSHiGG_01845
   00020 Citrate cycle (TCA cycle)
    CGSHiGG_01845
   00620 Pyruvate metabolism
    CGSHiGG_01845
Enzymes [BR:hiq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CGSHiGG_01845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 MSA-2c DEC-1_N
Motif
Other DBs
NCBI-ProteinID: ABQ99427
UniProt: A5UF72
Position
324613..326274
Genome map
AA seq 553 aa AA seqDB search
MSKQIQIPDIGSDEVTVTEVMVNVGDTISVDQSIINVEGDKASMEVPAPEAGVVKEILVK
VGDKVSTGTPMLVLEAAGAAPAADEPTAPVADAPTAPVVATAPTASAIVEVNVPDIGGDE
VNVTEIMVAVGDTITEEQSLITVEGDKASMEVPAPFGGVVKEILVKSGDKVSTGSLIMRF
EVLGAAPAESASASTSAPQAAAPATTAQAPQAAAPDTTAQAAQSNNNVSGLSQEQVEAST
GYAHATPVIRRLAREFGVNLDKVKGTGRKGRIVKEDIEAYVKTAVKAYESGATAQATGNG
VANGAGLGLLPWPKVDFSKFGEIEEVELSRINKISGANLHRNWVIIPHVTHFDKADITDL
EAFRKEQNALAEKQKLGVKITPVVFIMKAVAKALEAYPRFNSSITEDAQRLILKKYINIG
VAVDTPNGLVVPVFKNVNKKGIIELSRELMEVSKKAREGKLTASDMQGGCFTISSLGGIG
TTHFAPIVNAPEVAILGVSKSSMEPVWNGKEFAPRLILPMSLSFDHRVIDGADGARFISY
LGSVLADLRRLVM
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaacaaattcaaattcctgatattggtagtgatgaagttaccgtaacagaagtg
atggtaaacgtaggcgataccatttctgttgatcaatctatcattaacgttgaaggcgat
aaagcttcaatggaagtgcctgcaccagaagcgggtgttgtaaaagaaattttagtcaaa
gtgggcgataaagtttcaactggtactccaatgcttgtattagaagcggcaggtgctgct
ccagcagctgatgagcctactgctccagtagctgatgcgcctactgcaccagtggttgct
accgcaccaacggcttcagctattgtagaagtaaatgtgccagatattggtggtgatgaa
gtcaatgtaaccgaaattatggttgcagttggcgatacaatcactgaagaacaatcttta
attaccgttgaaggcgataaagcctcaatggaagttcctgcaccattcggcggtgtggta
aaagaaattttagtgaaatcaggcgataaagtttcaactggttcattaattatgcgtttt
gaagtactaggtgcagctccagcagaatcagcttcagcttcaacatcagcaccacaggca
gcagctcctgctactactgcacaagcaccacaggcagcagctcctgatactactgcacaa
gcagctcaatcaaataacaacgtatctggattaagccaagaacaagtagaagcaagtaca
ggatatgcacacgcaacaccagttattcgtcgtttagctcgtgaatttggtgtaaatcta
gataaagtaaaaggtactggtcgtaaaggtcgtatcgttaaagaagatattgaagcttat
gtgaagaccgcagttaaagcttatgaaagcggtgcaacagcacaagctactggcaatggt
gtagcaaatggtgctggattaggcttattgccatggccaaaagttgatttcagtaaattt
ggcgaaattgaagaagttgaattaagtcgtatcaacaaaatttcaggtgctaacttacat
cgtaactgggtaataattccacacgttactcacttcgataaagcagatatcacggattta
gaagcattccgtaaagaacaaaatgcgttagcagaaaaacaaaaacttggtgtaaaaatc
acgccagttgtgttcattatgaaagcggtggcaaaagcattagaagcgtatccacgtttc
aacagctcaattaccgaagatgctcaacgcttaatcctgaaaaaatatattaacatcggt
gtcgcagtagatacgccgaatggcttagtagtgcctgtattcaaaaatgtgaacaagaaa
ggcattatcgaactttcacgtgaattaatggaagtatcgaaaaaagcccgtgaaggcaaa
ttgactgcatcagatatgcaaggtggctgttttactatttcaagtcttggtggtattggt
acaacgcactttgcgccaatcgtaaacgcaccagaagttgccatccttggtgtgtctaaa
tcatcgatggaaccagtatggaatggtaaagaatttgcgccacgcttaattcttccaatg
tcattatcattcgaccaccgtgtcattgatggtgcagatggtgctcgtttcattagctat
cttggctcggttttagcagatttacgtcgcttagtaatgtaa

DBGET integrated database retrieval system