KEGG   Haemophilus influenzae PittGG (nontypeable): CGSHiGG_01995Help
Entry
CGSHiGG_01995     CDS       T00544                                 

Gene name
nrdB
Definition
(RefSeq) ribonucleotide-diphosphate reductase subunit beta (EC:1.17.4.1)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
hiq  Haemophilus influenzae PittGG (nontypeable)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hiq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CGSHiGG_01995 (nrdB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CGSHiGG_01995 (nrdB)
  Amino acid metabolism
   00310 Lysine degradation
    CGSHiGG_01995 (nrdB)
Enzymes [BR:hiq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CGSHiGG_01995 (nrdB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(354277..355506)
Genome map
AA seq 409 aa AA seqDB search
MTIEILVPDLPESVADATVATWHKKVGDTVKRDEVIVEIETDKVVLEVPALSDGVLAEVV
QAEGETVVSKQLLGKISTAQEGDVSSATLKATNEPTPSDRQNAAIENSHNHNADQSPAIR
RLLAEHDLQADQIQGSGVGGRLTREDIEREIAKRQAQQVKQEAATEQNTISTVAYSARSE
KRVPMTRLRKRIAERLLEAKNSTAMLTTFNEVDMQPIMTLRKTYGEKFEKQHGVRLGFMS
FYIKAVVEALKRYPEVNASIDGDDVVYHNYFDISIAVSTPRGLVTPVLRDCDKLSMAEIE
KQIKALAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKERPI
ALNGQVVIRPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLLEI
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgaaattcttgttccagacctacctgaatcagttgcggatgcaacagtggct
acttggcataaaaaagtaggtgataccgttaaacgtgatgaagtgattgttgaaattgaa
acggataaagttgtgctagaagtgcccgcactttctgatggcgtactggctgaagttgtt
caagctgagggtgaaactgtggtgagtaaacagctgttaggaaaaatttctacggctcaa
gaaggagatgtcagttcagcgacgttaaaagcaacgaatgaacccacaccatctgatcgt
caaaatgcagcgattgaaaatagtcataatcataatgcggatcagagccctgcaattcgt
cgtttattagcagaacatgatttacaagcagatcaaattcaaggttcgggtgtgggtggt
cgtttaacacgtgaagatattgaacgtgaaattgcaaaacgacaagcacagcaagtgaaa
caagaagctgccactgagcaaaatacaattagtacggtggcttatagcgcacgttctgaa
aaacgtgtgccaatgacccgtttgcgtaaacgtattgctgaacgtttacttgaagccaaa
aatagtacggcgatgcttaccactttcaatgaagtggatatgcagccgataatgactctg
cgtaaaacctacggcgaaaaatttgaaaaacaacatggtgtgcgtttaggatttatgtct
ttctatatcaaagcggttgtggaagcattaaaacgttatcctgaagtgaatgcttctatt
gatggggatgatgttgtttaccataactattttgatattagtattgcagtttcaacaccg
cgtggattagtcacaccagtgcttcgtgattgcgataagctcagtatggcagagatcgaa
aaacaaattaaagcattagctgaaaaaggtcgtgatggcaaattaacagtagaagatctt
actggcggcaattttactattacaaatggtggcgtgttcggttctcttatgtccactcca
attatcaatccaccacaaagtgcgattttaggaatgcacgctattaaagaacgcccgatt
gcgcttaatggtcaagttgtgattcgtcctatgatgtaccttgctttatcttacgatcat
cgtttaattgacggccgtgaatctgttggtttcttggtaacgattaaagaattattggaa
gatccaacaagattgttattagaaatctaa

DBGET integrated database retrieval system