KEGG   Haemophilus influenzae PittGG (nontypeable): CGSHiGG_01995Help
Entry
CGSHiGG_01995     CDS       T00544                                 

Gene name
nrdB
Definition
(GenBank) ribonucleotide-diphosphate reductase subunit beta
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
hiq  Haemophilus influenzae PittGG (nontypeable)
Pathway
hiq00020  Citrate cycle (TCA cycle)
hiq00310  Lysine degradation
hiq01100  Metabolic pathways
hiq01110  Biosynthesis of secondary metabolites
hiq01120  Microbial metabolism in diverse environments
hiq01130  Biosynthesis of antibiotics
hiq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hiq00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CGSHiGG_01995 (nrdB)
  Amino acid metabolism
   00310 Lysine degradation
    CGSHiGG_01995 (nrdB)
Enzymes [BR:hiq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CGSHiGG_01995 (nrdB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H Hep_59
Motif
Other DBs
NCBI-ProteinID: ABQ99451
UniProt: A5UF96
Position
complement(354277..355506)
Genome map
AA seq 409 aa AA seqDB search
MTIEILVPDLPESVADATVATWHKKVGDTVKRDEVIVEIETDKVVLEVPALSDGVLAEVV
QAEGETVVSKQLLGKISTAQEGDVSSATLKATNEPTPSDRQNAAIENSHNHNADQSPAIR
RLLAEHDLQADQIQGSGVGGRLTREDIEREIAKRQAQQVKQEAATEQNTISTVAYSARSE
KRVPMTRLRKRIAERLLEAKNSTAMLTTFNEVDMQPIMTLRKTYGEKFEKQHGVRLGFMS
FYIKAVVEALKRYPEVNASIDGDDVVYHNYFDISIAVSTPRGLVTPVLRDCDKLSMAEIE
KQIKALAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKERPI
ALNGQVVIRPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLLEI
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgaaattcttgttccagacctacctgaatcagttgcggatgcaacagtggct
acttggcataaaaaagtaggtgataccgttaaacgtgatgaagtgattgttgaaattgaa
acggataaagttgtgctagaagtgcccgcactttctgatggcgtactggctgaagttgtt
caagctgagggtgaaactgtggtgagtaaacagctgttaggaaaaatttctacggctcaa
gaaggagatgtcagttcagcgacgttaaaagcaacgaatgaacccacaccatctgatcgt
caaaatgcagcgattgaaaatagtcataatcataatgcggatcagagccctgcaattcgt
cgtttattagcagaacatgatttacaagcagatcaaattcaaggttcgggtgtgggtggt
cgtttaacacgtgaagatattgaacgtgaaattgcaaaacgacaagcacagcaagtgaaa
caagaagctgccactgagcaaaatacaattagtacggtggcttatagcgcacgttctgaa
aaacgtgtgccaatgacccgtttgcgtaaacgtattgctgaacgtttacttgaagccaaa
aatagtacggcgatgcttaccactttcaatgaagtggatatgcagccgataatgactctg
cgtaaaacctacggcgaaaaatttgaaaaacaacatggtgtgcgtttaggatttatgtct
ttctatatcaaagcggttgtggaagcattaaaacgttatcctgaagtgaatgcttctatt
gatggggatgatgttgtttaccataactattttgatattagtattgcagtttcaacaccg
cgtggattagtcacaccagtgcttcgtgattgcgataagctcagtatggcagagatcgaa
aaacaaattaaagcattagctgaaaaaggtcgtgatggcaaattaacagtagaagatctt
actggcggcaattttactattacaaatggtggcgtgttcggttctcttatgtccactcca
attatcaatccaccacaaagtgcgattttaggaatgcacgctattaaagaacgcccgatt
gcgcttaatggtcaagttgtgattcgtcctatgatgtaccttgctttatcttacgatcat
cgtttaattgacggccgtgaatctgttggtttcttggtaacgattaaagaattattggaa
gatccaacaagattgttattagaaatctaa

DBGET integrated database retrieval system