KEGG   Haemophilus influenzae PittGG (nontypeable): CGSHiGG_02750Help
Entry
CGSHiGG_02750     CDS       T00544                                 

Definition
beta-hexosamidase A
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
hiq  Haemophilus influenzae PittGG (nontypeable)
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:hiq00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CGSHiGG_02750
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    CGSHiGG_02750
Enzymes [BR:hiq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CGSHiGG_02750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(504656..506416)
Genome map
AA seq 586 aa AA seqDB search
MAVDLSKKPFYLNAEQIAWVENTIANMSLEEKIGQLFVNMGSSRSEEYLTNMVNKYHIGA
VRYNPAKAEEVYEQNHILQTKSKIPLLIAANTEAGGNGACTDGTEIGLQIKIAATQDAHY
AYEMGRVAGIEASAIGCNWSFAPIVDINYNWRNPIISNRSFSSDPDTVLEMALAYMKGIQ
ESGIQPSAKHFPGDGVDERDQHLSFSINGFSCEKWDETFGKVYQGLIDAGLPSIMAGHIH
LPSYEKYFSPELSDEECLPATLSKPLLTDLLRGKLGFNGVIVTDASHMVAMTSSMKRSEL
VPQAIAAGCDLFLFFNDPDEDFAYMMDGYRNGVITETRLYDALCRILGFKAKLNLHKTPK
EQILPPKEAAMAKIGLPENKAIFRQVADKAITLVKNKQAIFPISPEKHPRVLLVNIKGVE
GGFGKMVAGSSKSAIEILQEQLTKKGFSVSIYQSPMDNILALPDEEQVQAIRNEYSQKRP
ISDLVGQYDLIINVANVHMSTVQRIVWQATKGTPDIPFYVHEIPTIFVSVQCPFHLADVP
QVKTYINAYDGKQDTMEMLVEKLMGYSDFKGVSPVDAYCGFKDTYI
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atggctgttgatttaagtaaaaaaccattttatctcaatgctgaacaaattgcttgggta
gaaaatacgattgcaaatatgagtttagaagaaaaaattgggcaattatttgtcaatatg
ggttcaagtcgttcagaagaatatttaactaatatggttaataaatatcatattggagca
gtgcgttataacccagctaaggctgaagaggtttatgaacaaaatcatattttgcaaacg
aagagtaaaattccgcttttgattgcggcaaatactgaagcgggcggaaatggtgcttgt
acagatggcacggaaattggtcttcaaataaaaattgctgcgactcaagatgctcattat
gcctatgaaatgggcagagtagcggggattgaggcttcggctattggttgtaactggagt
tttgccccaattgtggacattaattataactggcgcaatcctattatttctaaccgctcg
tttagttctgatcctgataccgtattggaaatggcacttgcttatatgaaaggcattcaa
gaaagtggtattcaaccttccgctaaacatttcccaggagatggtgttgatgagcgagac
cagcatctttcctttagcattaatggcttttcatgtgaaaaatgggatgaaacattcggt
aaagtttatcaagggttaattgatgcagggttgccttctataatggcggggcatattcat
ctaccaagttatgagaaatatttttctccagaattaagtgatgaagagtgcttgcctgct
acactttctaaaccgcttttaacagatttattgcgtggaaaattagggtttaatggtgta
attgttactgatgcaagccatatggttgcaatgacatcaagcatgaaacgtagtgaactt
gttcctcaagctattgctgctggttgtgatttattcttattcttcaatgatccagatgaa
gattttgcttatatgatggatggataccgcaatggtgtcattactgaaacacgtttatat
gatgctctttgcagaatattaggttttaaagcgaaacttaatttgcataagacaccaaaa
gaacaaattctacctccaaaagaagctgctatggcaaaaattggactgccagaaaataaa
gcgattttccgtcaagttgctgataaagcgattacgcttgttaaaaataaacaagcaatt
ttcccgatttcgcctgaaaaacaccctcgagtgttattagtgaatattaaaggggttgag
ggaggctttggaaaaatggtcgcaggaagctcaaaaagtgccattgaaattttacaagag
caattgactaaaaaaggtttttccgtctcaatttatcagtctccgatggataatattcta
gctcttcccgatgaagaacaagtacaagcgattcgcaacgaatactcccaaaaacgtcca
atctctgatttagttggtcaatatgatttgattattaatgtagcaaatgtacatatgagt
accgtacagcgcatcgtgtggcaagcaactaaaggcacgccggatatacctttctatgtg
catgaaattccaacgatttttgtttctgtgcaatgtccattccatttggcagatgttcct
caagttaaaacttacattaatgcctatgatggaaaacaagacacgatggaaatgttagta
gaaaaattaatgggctattctgattttaaaggcgtaagcccggttgatgcatattgtggg
tttaaagatacttatatttaa

DBGET integrated database retrieval system