KEGG   Haemophilus influenzae PittGG (nontypeable): CGSHiGG_02835Help
Entry
CGSHiGG_02835     CDS       T00544                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
hiq  Haemophilus influenzae PittGG (nontypeable)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hiq00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
522033..522515
Genome map
AA seq 160 aa AA seqDB search
MITAYIALGSNLNTPVEQLHAALKAISQLPNTHLVTTSSFYKSKPLGPQDQPDYVNAVAK
IETELSPLKLLDELQRIENEQGRVRLRRWGERTLDLDILLYGNEIIQNERLTIPHYDMHN
REFVIVPLFEIASDLVLPNSQIITELVKQFADHKMIKLNP
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgattactgcatatattgcgctgggtagcaatttaaatacgccagtagaacaattacat
gctgcgcttaaagcgataagtcagttaccaaacactcatttagtaacgacgagctctttt
tataaaagcaaaccgctcggcccacaagatcaacccgattatgtgaatgccgttgcaaaa
attgaaaccgaacttagtccgctcaagctattagatgaattacagcgtattgaaaacgag
caaggtcgagtgcgtttacgtcgctggggcgaacgcacgttagatttagatattttgctc
tacggcaatgaaattattcaaaacgaacgcttaacaattccccattatgatatgcataac
cgtgagtttgtcattgtgccgttgtttgaaatcgcatcggatttagttttaccaaatagt
caaatcataacagagctggtcaagcaatttgctgaccacaaaatgataaaattaaatccc
tag

DBGET integrated database retrieval system