KEGG   Haemophilus influenzae PittGG (nontypeable): CGSHiGG_02985Help
Entry
CGSHiGG_02985     CDS       T00544                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hiq  Haemophilus influenzae PittGG (nontypeable)
Pathway
hiq00260  Glycine, serine and threonine metabolism
hiq00750  Vitamin B6 metabolism
hiq01100  Metabolic pathways
hiq01110  Biosynthesis of secondary metabolites
hiq01120  Microbial metabolism in diverse environments
hiq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hiq00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CGSHiGG_02985
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CGSHiGG_02985
Enzymes [BR:hiq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CGSHiGG_02985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ABQ99605
UniProt: A5UFQ0
Position
complement(545011..546288)
Genome map
AA seq 425 aa AA seqDB search
MNLYNIKHPEEQVTFSEAVRQGLGRDQGLFFPEVIPQLNNINELLELPLVERSQKILGAL
IDGELPQATLDAMVKNAFTFTAPLEKVEDNIYALELFHGPTLAFKDFGGRFMAQALAAVR
GDGKITILTATSGDTGAAVAHAFYGLENINVVILYPKGKISPLQEKLFCTLGGNIRTVAI
NADFDACQALVKQAFDDVELRQAIGLNSANSINISRLLAQVCYYFEAVAQLPKEKRDNVV
VSVPSGNFGNLTAGLIAKTLGLQIKRFVASTNANDTVPRYLKSGNWDPKTTVSTLSNAMD
VSRPNNWPRVEELFKRNGWDLTDLGSEMLSDSETEDTLKTMQSKGYLCEPHGAIAYQVLK
DQLKASEIGIFLCTAHPAKFKESVERILGIQLPLPETLDKHNQLPLLSDEMDNDFAQLRA
YLLKS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatacaatatcaaacacccagaagaacaagtcactttttctgaggctgttcgt
caaggtcttgggcgggatcaaggtctattctttccagaagttattcctcaacttaataac
attaatgaattacttgaattgcctcttgttgagcgtagtcaaaaaattctaggtgcatta
attgatggcgagttaccacaagcaacgttagatgcaatggtaaaaaatgcgtttactttc
actgcaccgttagaaaaagtggaagataatatttatgcacttgaattatttcacggtcca
acgctagcatttaaagattttggtgggcgttttatggctcaggcgcttgcagcagttcgt
ggtgatggcaaaattactattttaacggcaacctcaggcgatactggagccgctgtagca
catgcgttttatggattagaaaatattaatgtagttatcctttatccaaaaggcaaaatc
agcccattgcaagaaaagctgttctgtactttaggtgggaatattcgtactgttgcgatt
aacgctgatttcgatgcgtgtcaggctttggttaagcaagcctttgatgatgttgaattg
cgccaagctatcgggcttaactctgcaaattctattaatatcagccgtttattagctcaa
gtttgttattactttgaggctgtcgcacaattgccaaaagaaaaacgtgataatgtcgtg
gtttctgtgccaagtggtaattttggtaacttaacggcgggattaattgcaaaaacctta
ggattgcaaataaaacgctttgtcgcctcaacaaacgcaaatgatactgtgccacgttat
ttgaaatcgggtaattgggatcctaaaacgacagtttcaaccctttctaatgcaatggat
gtaagtcgcccaaataattggccgagagtggaggaattgtttaaacgaaatggttgggat
ttaactgatttaggttcggagatgctaagtgatagcgaaacagaagataccttaaaaacg
atgcagtcgaaaggttatttatgtgaacctcacggtgcgatagcttaccaagtgctgaaa
gatcaacttaaagcgagtgaaataggaatcttcctgtgtacggcacatcctgcgaaattt
aaagaatccgtagaacgtattcttggtattcagcttccattacctgaaacactggataaa
cataatcagctaccattgctttcagatgaaatggataatgattttgcacaactacgggct
tacttattgaagtcataa

DBGET integrated database retrieval system