KEGG   Haemophilus influenzae PittGG (nontypeable): CGSHiGG_05440Help
Entry
CGSHiGG_05440     CDS       T00544                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
hiq  Haemophilus influenzae PittGG (nontypeable)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hiq00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CGSHiGG_05440 (recR)
DNA repair and recombination proteins [BR:hiq03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CGSHiGG_05440 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
988384..988986
Genome map
AA seq 200 aa AA seqDB search
MQSSPLLEHLIENLRCLPGVGPKSAQRMAYHLLQRNRSGGMNLARALTEAMSKIGHCSQC
RDFTEEDTCNICNNPRRQNSGLLCVVEMPADIQAIEQTGQFSGRYFVLMGHLSPLDGIGP
REIGLDLLQKRLVEESFHEVILATNPTVEGDATANYIAEMCRQHNIKVSRIAHGIPVGGE
LETVDGTTLTHSFLGRRQID
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagcagtccacttttagaacaccttattgaaaacttacgttgtcttcctggcgta
gggcctaaatcggcgcaacgtatggcttatcatcttttacaacgtaatcgtagtggtgga
atgaatttagctcgagcactcacagaagctatgtctaaaattggccattgttcacaatgt
cgagactttacggaagaagatacttgcaacatttgcaataatccacgccgtcaaaattca
ggtttgctttgtgtcgttgaaatgccagcagatattcaagcgattgagcaaacagggcaa
ttttcaggacgttattttgttttaatgggacatttgtctccacttgatggtattggacct
cgtgaaattggcttagatttactgcaaaaacgcttagtagaagaatctttccacgaagtg
attcttgcaacaaacccaactgtggaaggcgatgcaacagcaaattacattgctgaaatg
tgccgccaacataatatcaaagtgagtcgtatcgctcacggtatccctgtcggaggggaa
cttgaaactgtggacggcacaacgcttactcactcttttctaggtcgtcgtcaaatcgac
taa

DBGET integrated database retrieval system