KEGG   Haemophilus influenzae PittGG (nontypeable): CGSHiGG_06500Help
Entry
CGSHiGG_06500     CDS       T00544                                 

Gene name
glmU
Definition
bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase (EC:2.7.7.23)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
hiq  Haemophilus influenzae PittGG (nontypeable)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:hiq00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CGSHiGG_06500 (glmU)
Enzymes [BR:hiq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CGSHiGG_06500 (glmU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1185612..1186553)
Genome map
AA seq 313 aa AA seqDB search
MIREPYFHQFALKELLPFFKQFPTQYLSGKQNIKLAYRHLIQPESAVRKLMILVNGRAEN
MLKWTELAYDFYHQGYDVLLFDHRGQGYSQRIIPQKGHLDEFRFYVDDMAKIIEKVTALF
SYSTQHLLAHSMGALIATYYLANYDHHINKAVLSSPFYGILLKHPIRDELIITLMNILGQ
GERYVFGKGPYQQAHLEYNELTFCKTRMKWMNRVNRKNPAINLGGPTFRWVHLCLNAIKR
LPKVIPKIEIPILILQAEKEKIVDNNNLEKLTALFPNAQCKVVFNAKHEVLFEKDNVRRN
VLKSVNHFLNVQS
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgatcagagaaccttattttcatcaatttgctcttaaagaattactgcctttttttaag
caatttccgacgcaatatctttctggtaaacaaaatataaaattagcttatcgtcatttg
attcaacctgaaagtgcggtcagaaaattgatgattttagtaaatggtcgagcagaaaat
atgctgaaatggactgaattggcttatgatttttatcatcaaggctatgatgtgctgcta
tttgatcaccgtggtcaaggctattcacagcgtattattcctcaaaaagggcatttagac
gaatttcgtttctatgttgatgatatggcgaaaatcatcgaaaaagtaaccgcacttttc
agctattcaacgcagcatttgcttgctcattcaatgggcgcattgattgcaacctattat
ttggcaaattatgatcatcacattaataaagcggtactttcttcgcctttttacggtatt
cttttaaaacatccaattagagatgaactgattattaccctaatgaatattttaggacaa
ggcgagcgttatgtttttggtaaagggccttatcaacaagcccacttggaatacaatgaa
ttaactttctgtaaaaccagaatgaaatggatgaatcgtgtaaatcgtaaaaatccagca
attaatcttggcgggccaacattccgttgggtacatttatgtttgaacgcaattaaacgc
ttgccgaaagttattcctaagattgaaattccaatcctaattttacaagccgaaaaagaa
aaaatagtagataacaacaatcttgaaaaattaaccgcactttttccgaatgctcaatgt
aaagttgtgttcaatgctaaacatgaggtgttatttgaaaaagataatgttcgaagaaat
gtacttaaaagtgttaatcattttctaaatgtgcaaagttga

DBGET integrated database retrieval system