KEGG   Haemophilus influenzae PittGG (nontypeable): CGSHiGG_06675Help
Entry
CGSHiGG_06675     CDS       T00544                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hiq  Haemophilus influenzae PittGG (nontypeable)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hiq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CGSHiGG_06675 (tpiA)
   01230 Biosynthesis of amino acids
    CGSHiGG_06675 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CGSHiGG_06675 (tpiA)
   00051 Fructose and mannose metabolism
    CGSHiGG_06675 (tpiA)
   00562 Inositol phosphate metabolism
    CGSHiGG_06675 (tpiA)
Enzymes [BR:hiq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CGSHiGG_06675 (tpiA)
Exosome [BR:hiq04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CGSHiGG_06675 (tpiA)
  Exosomal proteins of bladder cancer cells
   CGSHiGG_06675 (tpiA)
  Exosomal proteins of melanoma cells
   CGSHiGG_06675 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1216412..1217203
Genome map
AA seq 263 aa AA seqDB search
MARRPLVMGNWKLNGSKAFTKELIEGLKAELHDVTGCDVAIAPPVMYLGTAEAALSGCGC
SCGGKSVIQLGAQNVDINVKGAFTGDISSEMLKDFGAKYIIIGHSERRTYHKESDEFVAK
KFGALKEAGLVPVLCIGESEAENEAGKTEEVCARQIDAVINALGVEAFNGAVIAYEPIWA
IGTGKSATPAQAQAVHAFIRGHIAAKSQAVAEQVIIQYGGSVNDANAAELFTQPDIDGAL
VGGASLKAPAFAVIVKAAAAAKN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtcgtcctttagttatgggtaactggaaattaaacggtagcaaagcattcacg
aaagaattaatcgagggattaaaagcggaattacatgatgtaacaggttgtgatgtagca
attgccccccccgttatgtatttaggtacggctgaagcagcactttctggttgtggttgc
agctgtggcggtaaaagtgtgattcaattaggtgcacaaaacgtagatatcaatgtgaaa
ggtgcatttactggtgatatttctagcgaaatgttaaaagatttcggtgcaaaatatatc
attattggccactctgaacgccgcacttatcataaagaaagcgacgaatttgtggcgaaa
aaatttggtgcattaaaagaagctggtttagtgccagtattatgtattggtgaatctgaa
gcagaaaacgaagcaggcaaaacagaagaagtatgtgcgcgtcaaattgatgcagtcatc
aatgcattaggcgtagaagcattcaacggtgcagtgatcgcatacgaaccaatctgggca
attggcacgggtaaatctgcaactccagcacaagcacaagccgttcatgcatttatccgt
ggtcacatcgcagcgaaatcacaagccgtggcagagcaagtaattattcaatacggcggt
tctgtaaatgatgcaaatgccgctgaattatttactcagccagacatcgatggtgcatta
gtgggtggcgcatcattaaaagcccctgcatttgcagtaattgttaaagcagcagctgca
gcgaaaaactaa

DBGET integrated database retrieval system