KEGG   Haemophilus influenzae PittGG (nontypeable): CGSHiGG_06745Help
Entry
CGSHiGG_06745     CDS       T00544                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
hiq  Haemophilus influenzae PittGG (nontypeable)
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hiq00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    CGSHiGG_06745 (glpK)
Enzymes [BR:hiq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     CGSHiGG_06745 (glpK)
Exosome [BR:hiq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CGSHiGG_06745 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1229879..1231390
Genome map
AA seq 503 aa AA seqDB search
MTDKKYIIALDQGTTSSRAVLLDHNANVVEIAQREFTQIYPRAGWVEHNPMEIWATQSST
LNEVVAKSGITSDEIAAIGITNQRETTIVWEKSTGTPVYNAIVWQCRRTADITDKLKADG
YEEYIRNTTGLVVDPYFSGTKVKWILDNVEGAREKAERGELLFGTVDTWLVWKLTQGRVH
VTDYTNASRTMLFNIHTKQWDDKMLEILNIPRSILPEVRNSSEIYGQTNIGGKGGVRIPV
AGIAGDQQAALYGHLCVHAGQAKNTYGTGCFMLLHTGNKAITSKNGLLTTIACNAKGEPE
YALEGSVFIAGASIQWLRDELKIVHDSFDSEYFAQKVTDSNGVYVVPAFTGLGAPYWDPY
ARGAIFGLSRGANCNHIVRATLQSIAYQTRDVLEAMQSDSGERLQYLRVDGGATNNNFLM
QFQADILDVNVERPVVKEVTALGAAYLAGLATGFWKDLDELRDKARVERTFSPDSDNEKR
ERRYKGWKKAVKRSLEWAKEDEE
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgacagacaaaaaatacatcattgcattagaccaaggcacaacaagctctcgcgcagta
ttattagatcataatgcgaatgtggttgaaattgcacaacgtgaatttacccaaatctac
cctcgagctggttgggtagaacataacccaatggaaatttgggcaactcaaagctcaacc
ttaaacgaagtcgttgcaaaatcgggcattacatctgatgaaatcgctgctatcggtatc
accaaccaacgtgaaaccaccattgtatgggaaaaatcaacgggtacacctgtttacaac
gctatcgtttggcaatgccgccgtactgcagacattaccgataaattaaaagccgatggc
tatgaagaatatattcgtaataccacaggcttagtggttgacccttacttctctggtaca
aaagtaaaatggattttggataacgttgaaggcgcacgagaaaaagctgaacgaggcgaa
ttattatttggtaccgttgatacttggcttgtatggaaattgactcaaggccgagtgcac
gtaaccgattataccaacgcatctcgtaccatgttatttaacatccatactaaacaatgg
gatgacaagatgcttgaaatcttgaatattcctcgttcaatattacctgaagtacgtaat
tcttctgaaatttacggccaaaccaatatcggtggtaaaggtggtgtgcgtattcctgtt
gcagggattgctggtgaccaacaagccgctctttacggacatctttgcgtacatgcaggc
caagccaaaaacacttacggcacaggttgctttatgttactccacacgggtaacaaagct
attacatccaaaaatggactactcacaaccattgcttgtaatgcaaaaggcgaaccagaa
tatgccttagaaggttcagtatttatcgcgggtgcatcaatccaatggctccgtgatgaa
ctcaaaattgttcacgatagttttgactctgaatactttgcacaaaaagtgactgatagt
aatggcgtatatgttgttccagctttcacaggcttaggtgcaccatattgggatccatat
gcgcgcggtgcgatttttggtctttctcgcggtgcaaactgtaatcatattgttcgagca
accttacaatctattgcttaccaaacccgtgatgtcttagaggctatgcaatcagattcg
ggtgaacgattacaatatctccgtgtagatggtggtgcgacaaacaataacttcttaatg
caattccaagctgacattttagatgtaaatgtagagcgcccagttgtgaaagaagtgacc
gctctaggtgcagcttatcttgctggtttagcaacaggcttctggaaagatttagacgag
cttcgcgataaagcccgtgtagaacgcactttcagcccagacagcgacaatgaaaaacgt
gaacgtcgctacaaaggctggaaaaaagcagttaaacgctcattagaatgggcaaaagaa
gatgaagaataa

DBGET integrated database retrieval system