KEGG   Haemophilus influenzae PittGG (nontypeable): CGSHiGG_07280Help
Entry
CGSHiGG_07280     CDS       T00544                                 

Definition
phosphoglyceromutase (EC:6.3.5.3)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
hiq  Haemophilus influenzae PittGG (nontypeable)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hiq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CGSHiGG_07280
   01230 Biosynthesis of amino acids
    CGSHiGG_07280
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CGSHiGG_07280
  Energy metabolism
   00680 Methane metabolism
    CGSHiGG_07280
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CGSHiGG_07280
Enzymes [BR:hiq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CGSHiGG_07280
Exosome [BR:hiq04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CGSHiGG_07280
  Exosomal proteins of melanoma cells
   CGSHiGG_07280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1352561..1353244
Genome map
AA seq 227 aa AA seqDB search
MELVFIRHGFSEWNAKNLFTGWRDVNLTERGVEEAKAAGKKLLDKGYEFDIAFTSVLTRA
IKTCNIVLEESHQLWIPQVKNWRLNERHYGALQGLDKKATAEQYGDEQVHIWRRSYDISP
PDLDPQDPNSAHNDRRYANIPFDVVPNAENLKLTLERALPFWEDQIAPAMLSGKRVLVVA
HGNSLRALAKHIIGISDAEIMDFEIPTGQPLVLKLDDKLNYVEHYYL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggaattagtatttatccgtcacggttttagtgaatggaatgcaaaaaatttattcacg
ggttggcgtgatgtgaatttaactgaacgcggtgtggaagaagcaaaagctgcgggtaaa
aaactgttagacaaaggttatgaatttgacatcgcatttacctctgttttaactcgagca
atcaaaacttgtaacatcgtgttagaagaatcccaccaattatggattccgcaagtgaaa
aactggcgtttaaatgagcgtcactacggtgctttgcaaggtttagataaaaaagcgact
gcggagcaatacggtgacgaacaagttcatatttggcgtcgttcttatgatatttctcca
ccagatttagatccgcaagatccaaattctgcacacaatgaccgtcgttacgcaaatatt
ccatttgacgtagtaccaaacgcagaaaatttaaaattaacattagaacgagcattacca
ttctgggaagatcaaattgcgccagcaatgctttctggcaaacgtgttttagtagttgct
cacggtaattcacttcgtgcgttggcaaaacatattatcggtatttctgatgctgaaatt
atggattttgaaattccaacaggtcagcctttagttttaaaacttgatgataaattaaat
tatgtagaacattactatctttaa

DBGET integrated database retrieval system