KEGG   Haemophilus influenzae PittGG (nontypeable): CGSHiGG_08485Help
Entry
CGSHiGG_08485     CDS       T00544                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hiq  Haemophilus influenzae PittGG (nontypeable)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:hiq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CGSHiGG_08485
   01230 Biosynthesis of amino acids
    CGSHiGG_08485
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CGSHiGG_08485
   00030 Pentose phosphate pathway
    CGSHiGG_08485
   00051 Fructose and mannose metabolism
    CGSHiGG_08485
   00052 Galactose metabolism
    CGSHiGG_08485
  Energy metabolism
   00680 Methane metabolism
    CGSHiGG_08485
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CGSHiGG_08485
Enzymes [BR:hiq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CGSHiGG_08485
Protein phosphatases and associated proteins [BR:hiq01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CGSHiGG_08485
Messenger RNA biogenesis [BR:hiq03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CGSHiGG_08485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1567246..1568163)
Genome map
AA seq 305 aa AA seqDB search
MNAAIRGVVRSALAEGLEVFGIYDGYQGLYNNKIKQLNRYSVSDVINRGGTFLGSARFPE
FKDPNIRAKCAEILRSHGIDALVVIGGDGSYMGAKLLTEEHCFPCVGLPGTIDNDVAGTD
YTIGYQTALQTAVDAIDRLRDTSSSHQRISIVEIMGRHCSDLTISAGIAGGCEYIVASEI
EFNREELIQQIERSIIRGKRHAIIAITELLTDVHSLAKEIEARVGHETRATVLGHIQRGG
SPCAFDRILASRMGAYAVDLLLQGKGGYCVGIQNEQLVHHDIIDAINNMQRVFKADWLKV
AKRLE
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccgcaattcgtggcgtagtacgttctgcacttgcagaaggcttggaagtgttt
ggtatctatgatggttaccaaggtttatacaataataaaatcaaacaattaaatcgctat
agcgtatctgatgtcattaatcgtggcggtacttttttaggctctgcacgttttcctgaa
tttaaagatcctaatattcgggcaaaatgtgcggaaattttacgttctcacggcattgat
gcacttgtggttatcggtggtgacggttcttatatgggggcaaaattattaaccgaagaa
cactgtttcccttgtgttggattacccggtactattgataatgatgtggcaggtactgac
tataccatcggttatcaaaccgcattacaaactgcagtggatgcaatcgaccgtttacgt
gatacatcaagctcacaccaacgtatttctatcgttgaaattatgggtcgccattgtagt
gacttaacgatttctgcggggatcgctggcggttgcgaatatatcgtcgcatcagaaatt
gaatttaatcgcgaagaattaattcaacaaattgaacgtagcattattcgcggtaaacgc
cacgctattattgctatcactgaacttttaactgatgttcattctctggcaaaagaaatt
gaagctcgcgtaggccacgaaactcgcgcaaccgttttagggcatattcaacgtggtggt
tctccttgtgcttttgaccgtattcttgcctcacgtatgggcgcatacgcagtagattta
ttgctacaaggcaagggcggctattgcgtaggtatccaaaatgaacagctcgttcatcac
gatattattgatgccattaataatatgcagcgtgtatttaaggctgattggcttaaagtg
gcaaaacgtttggaataa

DBGET integrated database retrieval system