KEGG   Haemophilus influenzae PittGG (nontypeable): CGSHiGG_08485Help
Entry
CGSHiGG_08485     CDS       T00544                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hiq  Haemophilus influenzae PittGG (nontypeable)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:hiq01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hiq01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hiq00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:hiq00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hiq00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:hiq00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:hiq00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1567246..1568163)
Genome map
AA seq 305 aa AA seqDB search
MNAAIRGVVRSALAEGLEVFGIYDGYQGLYNNKIKQLNRYSVSDVINRGGTFLGSARFPE
FKDPNIRAKCAEILRSHGIDALVVIGGDGSYMGAKLLTEEHCFPCVGLPGTIDNDVAGTD
YTIGYQTALQTAVDAIDRLRDTSSSHQRISIVEIMGRHCSDLTISAGIAGGCEYIVASEI
EFNREELIQQIERSIIRGKRHAIIAITELLTDVHSLAKEIEARVGHETRATVLGHIQRGG
SPCAFDRILASRMGAYAVDLLLQGKGGYCVGIQNEQLVHHDIIDAINNMQRVFKADWLKV
AKRLE
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccgcaattcgtggcgtagtacgttctgcacttgcagaaggcttggaagtgttt
ggtatctatgatggttaccaaggtttatacaataataaaatcaaacaattaaatcgctat
agcgtatctgatgtcattaatcgtggcggtacttttttaggctctgcacgttttcctgaa
tttaaagatcctaatattcgggcaaaatgtgcggaaattttacgttctcacggcattgat
gcacttgtggttatcggtggtgacggttcttatatgggggcaaaattattaaccgaagaa
cactgtttcccttgtgttggattacccggtactattgataatgatgtggcaggtactgac
tataccatcggttatcaaaccgcattacaaactgcagtggatgcaatcgaccgtttacgt
gatacatcaagctcacaccaacgtatttctatcgttgaaattatgggtcgccattgtagt
gacttaacgatttctgcggggatcgctggcggttgcgaatatatcgtcgcatcagaaatt
gaatttaatcgcgaagaattaattcaacaaattgaacgtagcattattcgcggtaaacgc
cacgctattattgctatcactgaacttttaactgatgttcattctctggcaaaagaaatt
gaagctcgcgtaggccacgaaactcgcgcaaccgttttagggcatattcaacgtggtggt
tctccttgtgcttttgaccgtattcttgcctcacgtatgggcgcatacgcagtagattta
ttgctacaaggcaagggcggctattgcgtaggtatccaaaatgaacagctcgttcatcac
gatattattgatgccattaataatatgcagcgtgtatttaaggctgattggcttaaagtg
gcaaaacgtttggaataa

DBGET integrated database retrieval system