KEGG   Haemophilus influenzae PittGG (nontypeable): CGSHiGG_08485Help
Entry
CGSHiGG_08485     CDS       T00544                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hiq  Haemophilus influenzae PittGG (nontypeable)
Pathway
hiq00010  Glycolysis / Gluconeogenesis
hiq00030  Pentose phosphate pathway
hiq00051  Fructose and mannose metabolism
hiq00052  Galactose metabolism
hiq00680  Methane metabolism
hiq01100  Metabolic pathways
hiq01110  Biosynthesis of secondary metabolites
hiq01120  Microbial metabolism in diverse environments
hiq01130  Biosynthesis of antibiotics
hiq01200  Carbon metabolism
hiq01230  Biosynthesis of amino acids
hiq03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:hiq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CGSHiGG_08485
   00030 Pentose phosphate pathway
    CGSHiGG_08485
   00051 Fructose and mannose metabolism
    CGSHiGG_08485
   00052 Galactose metabolism
    CGSHiGG_08485
  Energy metabolism
   00680 Methane metabolism
    CGSHiGG_08485
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CGSHiGG_08485
Enzymes [BR:hiq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CGSHiGG_08485
Protein phosphatases and associated proteins [BR:hiq01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CGSHiGG_08485
Messenger RNA biogenesis [BR:hiq03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CGSHiGG_08485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ABR00527
UniProt: A5UIC1
Position
complement(1567246..1568163)
Genome map
AA seq 305 aa AA seqDB search
MNAAIRGVVRSALAEGLEVFGIYDGYQGLYNNKIKQLNRYSVSDVINRGGTFLGSARFPE
FKDPNIRAKCAEILRSHGIDALVVIGGDGSYMGAKLLTEEHCFPCVGLPGTIDNDVAGTD
YTIGYQTALQTAVDAIDRLRDTSSSHQRISIVEIMGRHCSDLTISAGIAGGCEYIVASEI
EFNREELIQQIERSIIRGKRHAIIAITELLTDVHSLAKEIEARVGHETRATVLGHIQRGG
SPCAFDRILASRMGAYAVDLLLQGKGGYCVGIQNEQLVHHDIIDAINNMQRVFKADWLKV
AKRLE
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccgcaattcgtggcgtagtacgttctgcacttgcagaaggcttggaagtgttt
ggtatctatgatggttaccaaggtttatacaataataaaatcaaacaattaaatcgctat
agcgtatctgatgtcattaatcgtggcggtacttttttaggctctgcacgttttcctgaa
tttaaagatcctaatattcgggcaaaatgtgcggaaattttacgttctcacggcattgat
gcacttgtggttatcggtggtgacggttcttatatgggggcaaaattattaaccgaagaa
cactgtttcccttgtgttggattacccggtactattgataatgatgtggcaggtactgac
tataccatcggttatcaaaccgcattacaaactgcagtggatgcaatcgaccgtttacgt
gatacatcaagctcacaccaacgtatttctatcgttgaaattatgggtcgccattgtagt
gacttaacgatttctgcggggatcgctggcggttgcgaatatatcgtcgcatcagaaatt
gaatttaatcgcgaagaattaattcaacaaattgaacgtagcattattcgcggtaaacgc
cacgctattattgctatcactgaacttttaactgatgttcattctctggcaaaagaaatt
gaagctcgcgtaggccacgaaactcgcgcaaccgttttagggcatattcaacgtggtggt
tctccttgtgcttttgaccgtattcttgcctcacgtatgggcgcatacgcagtagattta
ttgctacaaggcaagggcggctattgcgtaggtatccaaaatgaacagctcgttcatcac
gatattattgatgccattaataatatgcagcgtgtatttaaggctgattggcttaaagtg
gcaaaacgtttggaataa

DBGET integrated database retrieval system