KEGG   Haemophilus influenzae PittGG (nontypeable): CGSHiGG_08915Help
Entry
CGSHiGG_08915     CDS       T00544                                 

Definition
putative type III restriction-modification system HindVIP enzyme res
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
hiq  Haemophilus influenzae PittGG (nontypeable)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1649002..1651158)
Genome map
AA seq 718 aa AA seqDB search
MANNKTLFDWVEDRKSTLEEMEQTDFFALPEFVERNLKYSFFEWQKSALENFLIFDRTPK
LKDFPNIKNRPTHLLFNMATGAGKTMMMAALILYYFEKGYRHFLFFVNQNNIVDKTENNF
IDPTHAKFLFTEKILQGDTVIPIRKVETFSPHSDGIEIKFTSIQKLYNDIHTERENQTTL
ADLHKLNLVMLGDEAHHLNAQTKGKKQGELDLEKEMNDRTSKAEIERKGWEHMVLELLLN
KNGNPSENVLLEFTATLPENAEVQQKYADKIITKFGLKEFLQKGYTKEINLVSSTLGKKE
RVLHTLLFAWYRHQIALKYGIANFKPVMLFRSKTIDESKADYLAFLNWVENVQAVDFSFL
TTFLASLNDSDNANEQGKTRTEQALKFIQDNKFEFVHLADWVKQNYQKHNVIITNSETNK
SKTEKTDSETEKLLNNLEAADNPIRAIFTVDRLTEGWDVLNLFDIVRLYEGQNGGGSNKK
SGKTAAATVSEKQLIGRGVRYFPFAFEDKQPNKRKFDNDMQHELRILEELFYYTHDEQSR
YISELKAELRKDGFIPENDKDKVLTTFKLKSEFADNENFKNLLIWANKKIPNPNAKANNA
DSLKANPQPLPFPVHGKLLQETQFTADENDEKARQIGTQNNFTETIEMSEIERHIFNKAL
HIKGKNSQSLFHFDRLQSKLNIQNRNELQNNLLKDWQIEFLGLGKINRLAQMTNLQAA
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atggcgaataataaaacgttgtttgattgggtggaagaccgcaaatcaaccctagaagaa
atggagcagacggattttttcgcactgcctgaatttgtagaacgcaatttaaaatattcg
ttttttgaatggcaaaaatccgcccttgaaaactttttgatttttgaccgcactccaaaa
ttaaaggatttccccaacatcaaaaaccgccctacccatttgctgttcaatatggcaaca
ggagccggcaaaacgatgatgatggcggcgttgattttgtattattttgaaaagggttat
cggcattttctgttttttgtgaatcaaaacaatatcgtagataaaacggaaaataatttt
attgacccgacgcacgcgaaatttttatttaccgagaagattttgcagggcgatacggta
attcctattcgcaaagtggaaacatttagtccacattcagacggcattgaaattaaattt
accagcattcaaaaactgtataacgatatccacaccgagcgagaaaaccaaaccacattg
gcagatttgcacaaattgaaccttgtgatgctgggcgatgaagcgcaccatttaaacgcg
caaaccaaaggcaaaaaacaaggcgaattagatttagaaaaggaaatgaacgaccgcacc
agcaaagccgaaattgaacgcaaaggctgggagcatatggttttggaattgttactcaat
aaaaatggcaatcccagcgaaaatgtgctgttggaatttaccgccacactgcctgaaaat
gctgaagtgcaacaaaaatatgctgataaaatcatcacaaaatttggtttaaaagaattt
ttgcaaaaaggttataccaaagaaatcaatttggtatccagtacgctgggcaagaaagag
cgagtattgcacactttattgtttgcttggtatcgccatcaaattgcattgaaatatggc
attgccaatttcaagcctgtgatgttgtttagaagtaagacgattgatgaatcaaaggcg
gattatttggcatttttaaattgggtagaaaatgtgcaagcggttgatttttcgttttta
acgacatttttggcaagcttaaacgatagcgataacgccaacgaacaaggcaaaacccgt
accgaacaagccctaaaatttatacaggacaataaatttgagtttgtgcatttggcagat
tgggtaaaacaaaattatcaaaaacacaatgtcattatcaccaactccgaaaccaacaaa
agcaaaacagaaaaaaccgacagtgaaacggaaaaattgctaaataatttggaagcggct
gataatccgatccgtgctatttttacggtggacagattaactgaaggttgggacgttctg
aatttgtttgatattgtgcgtttgtatgaagggcaaaacggcggcggttcaaataaaaaa
tcgggcaaaacggctgccgccaccgtatcagaaaagcagttaattggtcgtggcgtgcgt
tattttccatttgcgtttgaagataaacagccgaataaacgcaaatttgacaacgatatg
caacacgaattgcgtattttggaagaattgttttattacacgcacgatgagcaatctcgc
tatatttcagaattaaaagcagaacttcgcaaagatggctttattcccgaaaacgataaa
gataaagttttaaccacattcaaactaaaatctgaatttgcagataatgaaaattttaaa
aacttattgatttgggcgaataaaaaaatccctaatcccaatgccaaagccaataatgca
gacagcctaaaagccaatccgcaaccgcttccattcccagttcacggcaaattgttgcaa
gaaacgcaatttacagccgatgaaaatgatgaaaaagcccgacaaatcggcacacaaaat
aattttactgaaaccatagaaatgagtgaaatagagcggcacatttttaataaagccttg
catatcaaaggaaaaaatagtcaatctttattccattttgaccgcttacaaagcaaactc
aacattcaaaatcgcaatgaattgcaaaataacttgttaaaagattggcaaattgaattt
ttgggattgggcaagataaacagattagcccagatgacaaacttgcaggctgcctga

DBGET integrated database retrieval system