KEGG   Haemophilus influenzae PittGG (nontypeable): CGSHiGG_09790Help
Entry
CGSHiGG_09790     CDS       T00544                                 

Definition
thiol-disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hiq  Haemophilus influenzae PittGG (nontypeable)
Brite
Enzymes [BR:hiq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CGSHiGG_09790
Secretion system [BR:hiq02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   CGSHiGG_09790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1808768..1809457
Genome map
AA seq 229 aa AA seqDB search
MKKIFTALLCVAAANAMADDAAIKRKLQSFNISNIVIKSSPISGIKTAVTDQGILYVSED
GKYLFEGKLYELTNNGPVDVAGKILVDKLNSYKDEMIVYPAKNEKHVVTVFMDITCHYCH
LLHQQLKEYNDLGITVRYLAFPRAGMNNQTAKQMEAIWTAKDPVFALNEAEKGNLPKEVK
TPNIVKKHYELGIQFGVRGTPSIVTSTGELIGGYLKPADLLSALEETAQ
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatttttaccgcacttttgtgcgtggctgcggctaatgcaatggcagatgat
gcggcaattaaacgcaaattacagtcttttaatatatcaaatattgttattaaatcttcg
ccgatttcaggcattaaaacggctgtcacggatcaaggtatactttatgtgagcgaagat
ggaaaatatctttttgaaggtaaactttatgaactcacaaataatggccctgttgatgta
gcaggtaaaattttagtagataaacttaattcttataaagacgagatgattgtttatcct
gcgaaaaatgaaaaacacgtagtaacagtatttatggatattacctgccattattgccat
ttattacatcagcaattaaaagaatataacgatcttggcattaccgtgcgttatttagct
ttccctcgtgcaggtatgaataatcaaacggcgaaacaaatggaagcgatttggacggcg
aaagatcccgtttttgctttaaatgaagcagaaaaaggcaatttaccaaaagaagttaaa
acgccaaatatcgtgaaaaaacattatgaattaggtattcaatttggtgtacgaggaaca
ccaagtattgttacctcaactggtgagcttattggcggttatttaaaaccagctgattta
ttgagcgcacttgaagaaacggcacaataa

DBGET integrated database retrieval system