KEGG   Haemophilus influenzae 86-028NP (nontypeable): NTHI0015Help
Entry
NTHI0015          CDS       T00248                                 

Gene name
holD
Definition
DNA polymerase III subunit psi (EC:2.7.7.7)
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
hit  Haemophilus influenzae 86-028NP (nontypeable)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:hit00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NTHI0015 (holD)
   00240 Pyrimidine metabolism
    NTHI0015 (holD)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    NTHI0015 (holD)
   03430 Mismatch repair
    NTHI0015 (holD)
   03440 Homologous recombination
    NTHI0015 (holD)
Enzymes [BR:hit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     NTHI0015 (holD)
DNA replication proteins [BR:hit03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     NTHI0015 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(11864..12268)
Genome map
AA seq 134 aa AA seqDB search
MNRRDLLLQEMGISQWELYRPEVLQGSVGISVAENIRFITVSNENISSSPLLADVLLSLN
LKKENCLCLNYDQIQHMECKQPIRYWLLSENNDQIDRTLPFCKQAEQVYRSPSWQQFQSN
HQAKRALWQQIQQP
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgaacagacgcgatcttcttttacaagaaatgggcatttcccagtgggaattatatcgc
cccgaggtactgcaaggttcagtaggaattagtgtggcagagaatattcgctttatcact
gtttccaatgaaaatatcagtagctcgcctttgttggctgatgtgctgttaagccttaat
cttaaaaaagaaaattgtttatgtttgaattacgatcaaatccagcatatggaatgtaag
cagcctattcgttactggttactatcagaaaataacgaccaaattgaccgcactttgcca
ttttgcaagcaggctgagcaggtttatcgctcgccaagttggcagcaatttcaatctaat
catcaagccaaacgagcgttgtggcaacaaattcagcagccttaa

DBGET integrated database retrieval system