KEGG   Haemophilus influenzae 86-028NP (nontypeable): NTHI0165Help
Entry
NTHI0165          CDS       T00248                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hit  Haemophilus influenzae 86-028NP (nontypeable)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hit00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NTHI0165 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NTHI0165 (thrC)
Enzymes [BR:hit01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     NTHI0165 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(149016..150293)
Genome map
AA seq 425 aa AA seqDB search
MNLYNIKHPEEQVTFSQAVRQGLGWDQGLFFPEVIPKLNNINELLELPLVERSQKILGAL
IDGELPQATLDAMVKNAFTFTAPLEKVEDNIYALELFHGPTLAFKDFGGRFMAQALAAVR
GDGKITILTATSGDTGAAVAHAFYGLENINVVILYPKGKISPLQEKLFCTLGGNIRTVAI
NADFDACQALVKQAFDDVELRQAIGLNSANSINISRLLAQVCYYFEAVAQLPKEKRDNVV
VSVPSGNFGNLTAGLIAKTLGLPIKRFVASTNANDTVPRYLKSGNWDPKTTVATLSNAMD
VSRPNNWPRVEELFKRNGWDLTDLGSGMLSDSETEDTLKAMQSKGYLCEPHGAIAYQVLK
EQLKASETGIFLCTAHPAKFKESVERILGIQLPLPETLDKHNQLPLLSDEMDNDFAQLRA
YLLKS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatacaatatcaaacacccagaagaacaagtcactttttctcaggctgttcgt
caaggtcttgggtgggatcaaggtctattctttccagaagttattcctaaacttaataac
attaatgaattacttgaattgcctcttgttgagcgtagtcaaaaaattctaggtgcatta
attgatggcgagttaccacaagcaacgttagatgcaatggtaaaaaatgcgtttactttc
actgcaccgttagaaaaagtggaagataatatttatgcacttgaattatttcacggtcca
acgctagcatttaaagattttggtgggcgttttatggcacaggcacttgctgcggtacgt
ggcgatggcaaaattactattttaacggcaacctcaggcgatactggagccgctgtagca
catgcgttttatggattagaaaatattaatgtagttatcctttatccaaaaggcaaaatt
agcccattacaagaaaagctattctgtactttaggtgggaatattcgtactgttgcgatt
aacgctgatttcgatgcgtgtcaggctttggttaagcaagcctttgatgatgttgaattg
cgccaagctatcgggctgaactctgcaaattctattaatatcagccgtttattagctcaa
gtttgttattactttgaggctgtcgcacaattgccaaaagaaaaacgtgataatgtcgtg
gtttctgtgccaagtggtaattttggtaacttaacggcgggattaattgcaaaaacctta
ggcttgccgataaaacgctttgtcgcctcaacaaacgcaaatgatactgtgccacgttat
ttgaaatcgggtaattgggatcctaaaacgacagttgcaaccctttctaatgcaatggat
gtaagtcgcccaaacaattggccgagagtggaagaattgtttaaacgaaatggttgggat
ttaactgatttaggttcggggatgctaagtgatagcgaaacagaagataccttaaaagcg
atgcagtcgaaaggttatttatgtgaacctcacggtgcgatagcttatcaggtgttgaaa
gagcaacttaaagcgagtgaaacaggaatcttcttgtgtacggcgcatcctgcgaaattt
aaagaatccgtagaacgtattcttggtattcagcttccattacctgaaacactggataaa
cataatcagctaccattgctttcagatgaaatggataatgattttgcacaactacgggct
tacttattgaagtcataa

DBGET integrated database retrieval system