KEGG   Haemophilus influenzae 86-028NP (nontypeable): NTHI0431Help
Entry
NTHI0431          CDS       T00248                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
hit  Haemophilus influenzae 86-028NP (nontypeable)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hit00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NTHI0431 (ruvA)
Enzymes [BR:hit01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     NTHI0431 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(413621..414235)
Genome map
AA seq 204 aa AA seqDB search
MIGRLQGILLEKQPPEILLNVQGVGYELLLPMTSFYDLPEIGQETTLFTHLVVREDAHLL
FGFAQKTDRTLFRELIKTNGVGPKLALAILSAMSVEQFAYAIEREELSKLTKIPGVGKKT
AERLLVELKGKFKGIKQSDFFVESTHIPLSPSIESHSESSSDEAISALIALGYKPAEAEK
MVKRVAKPELTSEQVIREALKAAL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtcgcttacaaggcattcttttagaaaaacaacctccagaaattttactcaat
gtgcaaggcgtaggctatgaattgcttttgccgatgacgagtttctatgatttaccagaa
attggacaagaaactactttattcacccatcttgttgttcgggaagatgctcacttactc
tttggatttgcccagaaaacagaccgcactttatttcgtgaattaattaaaacaaatggg
gttgggcctaaattagccttagcgattttatccgccatgtcggtcgaacaatttgcttac
gcaatagagagagaagaactttctaaactcactaaaattccaggtgttggcaaaaaaaca
gctgaacgtttgttagttgaactcaaaggtaaatttaaaggcataaaacaaagtgatttc
tttgtagaaagtacgcatattccattatccccatctattgaatcccactcggaaagttca
tctgatgaagcaatttcagccttgattgctttaggttataaacctgcagaagcagaaaaa
atggtaaaacgcgttgctaaacctgaattaaccagtgaacaagttattcgtgaagcatta
aaagccgcattgtag

DBGET integrated database retrieval system