KEGG   Haemophilus influenzae 86-028NP (nontypeable): NTHI0431Help
Entry
NTHI0431          CDS       T00248                                 

Gene name
ruvA
Definition
(GenBank) holliday junction DNA helicase RuvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
hit  Haemophilus influenzae 86-028NP (nontypeable)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hit00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NTHI0431 (ruvA)
Enzymes [BR:hit01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     NTHI0431 (ruvA)
DNA repair and recombination proteins [BR:hit03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     NTHI0431 (ruvA)
    RecFOR pathway proteins
     NTHI0431 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(413621..414235)
Genome map
AA seq 204 aa AA seqDB search
MIGRLQGILLEKQPPEILLNVQGVGYELLLPMTSFYDLPEIGQETTLFTHLVVREDAHLL
FGFAQKTDRTLFRELIKTNGVGPKLALAILSAMSVEQFAYAIEREELSKLTKIPGVGKKT
AERLLVELKGKFKGIKQSDFFVESTHIPLSPSIESHSESSSDEAISALIALGYKPAEAEK
MVKRVAKPELTSEQVIREALKAAL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtcgcttacaaggcattcttttagaaaaacaacctccagaaattttactcaat
gtgcaaggcgtaggctatgaattgcttttgccgatgacgagtttctatgatttaccagaa
attggacaagaaactactttattcacccatcttgttgttcgggaagatgctcacttactc
tttggatttgcccagaaaacagaccgcactttatttcgtgaattaattaaaacaaatggg
gttgggcctaaattagccttagcgattttatccgccatgtcggtcgaacaatttgcttac
gcaatagagagagaagaactttctaaactcactaaaattccaggtgttggcaaaaaaaca
gctgaacgtttgttagttgaactcaaaggtaaatttaaaggcataaaacaaagtgatttc
tttgtagaaagtacgcatattccattatccccatctattgaatcccactcggaaagttca
tctgatgaagcaatttcagccttgattgctttaggttataaacctgcagaagcagaaaaa
atggtaaaacgcgttgctaaacctgaattaaccagtgaacaagttattcgtgaagcatta
aaagccgcattgtag

DBGET integrated database retrieval system