KEGG   Haemophilus influenzae 86-028NP (nontypeable): NTHI0570Help
Entry
NTHI0570          CDS       T00248                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
hit  Haemophilus influenzae 86-028NP (nontypeable)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hit03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
531407..532009
Genome map
AA seq 200 aa AA seqDB search
MQSSPLLEHLIENLRCLPGVGPKSAQRMAYHLLQRNRSGGMNLARALTEAMSKIGHCSQC
RDFTEEDTCNICNNPRRQNSGLLCVVEMPADIQAIEQTGQFSGRYFVLMGHLSPLDGIGP
REIGLDLLQKRLVEESFHEVILATNPTVEGDATANYIAEMCRQHNIKVSRIAHGIPVGGE
LETVDGTTLTHSFLGRRQID
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagcagtccacttttagaacaccttattgaaaacttacgttgtcttccaggcgta
gggcctaaatctgcgcaacgtatggcttatcatcttttacagcgtaatcgtagcggtgga
atgaatttagctcgagcactcacagaagctatgtctaaaattggtcattgttcacaatgt
cgagactttacggaagaagacacttgcaacatttgcaataatccacgccgtcaaaattca
ggtttgctttgtgtcgttgaaatgcccgcagatattcaagcgattgagcaaacggggcaa
ttttcaggacgttattttgttttaatgggacatttgtctccacttgatggtattgggcct
cgtgaaattggcttagatttactgcaaaaacgcttagtagaagaatctttccacgaagtg
attcttgcaacaaatccaacagtggagggcgatgcgacggcaaactacattgctgaaatg
tgccgccaacataatatcaaagtgagtcgtatcgctcacggtatccctgtcggtggtgaa
ctagaaactgtggacggcacaacgcttactcactcttttctaggtcgtcgtcaaatcgac
taa

DBGET integrated database retrieval system