KEGG   Haemophilus influenzae 86-028NP (nontypeable): NTHI0800Help
Entry
NTHI0800          CDS       T00248                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hit  Haemophilus influenzae 86-028NP (nontypeable)
Pathway
hit00010  Glycolysis / Gluconeogenesis
hit00051  Fructose and mannose metabolism
hit00562  Inositol phosphate metabolism
hit01100  Metabolic pathways
hit01110  Biosynthesis of secondary metabolites
hit01120  Microbial metabolism in diverse environments
hit01130  Biosynthesis of antibiotics
hit01200  Carbon metabolism
hit01230  Biosynthesis of amino acids
Module
hit_M00002  Glycolysis, core module involving three-carbon compounds
hit_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hit00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NTHI0800 (tpiA)
   00051 Fructose and mannose metabolism
    NTHI0800 (tpiA)
   00562 Inositol phosphate metabolism
    NTHI0800 (tpiA)
Enzymes [BR:hit01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NTHI0800 (tpiA)
Exosome [BR:hit04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NTHI0800 (tpiA)
  Exosomal proteins of bladder cancer cells
   NTHI0800 (tpiA)
  Exosomal proteins of melanoma cells
   NTHI0800 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AAX87709
UniProt: Q4QMN8
Position
752410..753201
Genome map
AA seq 263 aa AA seqDB search
MARRPLVMGNWKLNGSKAFTKELIEGLKAELHDVTGCDVAIAPPVMYLGTAEAALSGCGC
SCGGKSVIQLGAQNVDINVKGAFTGDISSEMLKDFGAKYIIIGHSERRTYHKESDEFVAK
KFGALKEAGLVPVLCIGESEAENEAGKTEEVCARQIDAVINALGVEAFNGAVIAYEPIWA
IGTGKSATPAQAQAVHAFIRGHIAAKSQAVAEQVIIQYGGSVNDANAAELFTQPDIDGAL
VGGASLKAPAFAVIVKAAAAAKN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtcgtcctttagttatgggtaactggaaattaaacggtagcaaagcattcacg
aaagaattaatcgagggattaaaagcggaattacatgatgtaacaggttgtgatgtagca
attgccccccccgttatgtatttaggtacggctgaagcagcactttctggttgtggttgc
agctgtggcggtaaaagtgtgattcaattaggtgcacaaaacgtagatatcaatgtgaaa
ggtgcatttactggtgatatttctagcgaaatgttaaaagatttcggtgcaaaatatatc
attattggccactctgaacgccgcacttatcataaagaaagcgacgaatttgtggcgaaa
aaatttggtgcattaaaagaagctggtttagtgccagtattatgtattggtgaatctgaa
gcagaaaacgaagcaggcaaaacagaagaagtatgtgcgcgtcaaattgatgcagtcatc
aatgcattaggcgtagaagcattcaacggtgcagtgatcgcatacgaaccaatctgggca
attggcacgggtaaatctgcaactccagcacaagcacaagccgttcatgcatttatccgt
ggtcacatcgcagcgaaatcacaagccgtggcagagcaagtaattattcaatacggcggt
tctgtaaatgatgcaaatgccgctgaattatttactcagccagacatcgatggtgcatta
gtgggtggcgcatcattaaaagcccctgcatttgcagtaattgttaaagcagcagctgca
gcgaaaaactaa

DBGET integrated database retrieval system