KEGG   Haemophilus influenzae 86-028NP (nontypeable): NTHI0871Help
Entry
NTHI0871          CDS       T00248                                 

Gene name
fucI
Definition
(GenBank) L-fucose isomerase
  KO
K01818  
L-fucose/D-arabinose isomerase [EC:5.3.1.25 5.3.1.3]
Organism
hit  Haemophilus influenzae 86-028NP (nontypeable)
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hit00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    NTHI0871 (fucI)
Enzymes [BR:hit01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.3  D-arabinose isomerase
     NTHI0871 (fucI)
    5.3.1.25  L-fucose isomerase
     NTHI0871 (fucI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(827399..829213)
Genome map
AA seq 604 aa AA seqDB search
MISSFLLKHKQRSVTMALATQLNRIKIGIRPTIDGRRMGVRESLETQTMRMAQSVAQLLQ
THIRHTDGTFVECVVADSTIGGVAEAAVCADKFKRENVGLTITVTPCWCYGSETIDMDPH
MPKAIWGFNGTERPGAVYLAAALAGHSQLGLPAFSIYGTEVQEADDTNIPEDVKEKLLRF
ARAGLAVASIRGKSYLSIGSVSMGIAGSIVNQAFFQEYLGMRNEYVDMMEIKRRLDRKIY
DQEEVDLALSWVKQYCKEGVDVNSLENQRNAEERAELWENVVKMTIITRDLMVGNPKLAT
LNYAEEALGHNAIAAGFQGQRHWTDHLPNGDFMEAMLNSTYDWNGVRPPYILATENDSLN
AIGMLFGHQLTGKAQIFADVRTYWSQDSVERVTGWRPESGFIHLINSGSAALDGTGEHQD
AQGNPTLKPAWDVTEEEAKRCLENTRWCPAVHEYFRGGGLSSQFLTKGGIPFTMHRINLI
KGLGPVLQIAEGWSIDLPQDVHNKLNQRTNETWPTTWFVPRLTGKGAFTDVYSVMANWGA
NHCVATHGHVGADLITLASMLRIPVCMHNVSEKNIFRPSAWNGFGQDKEGQDYRACQNFG
PLYK
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
gtgatttcatcattcttacttaagcacaaacaaaggagtgtaactatggctcttgctact
caattaaatcgcataaaaatcggtattcgtccaactattgatggtcgtcgaatgggagtt
cgagaatctcttgaaacccaaacaatgcgtatggctcaatctgttgctcaattattacaa
acacatattcgtcatacagatggtactttcgttgaatgtgtagttgcagatagcactatc
ggtggtgtagctgaagcagccgtctgtgcggataaatttaaacgcgaaaacgttggatta
accattaccgttaccccttgttggtgttatggatcagaaaccattgatatggatcctcac
atgcctaaagcaatttggggatttaacggcacagaacgcccaggcgcggtttacttagct
gctgcccttgctggtcattctcaattaggactaccagccttttccatttacggtacagaa
gttcaagaagctgatgacacaaacattcctgaagatgtaaaagaaaaattattgcgtttt
gctcgtgctgggcttgctgttgcaagtattcgaggaaaatcctatttatctattgggtca
gtttccatgggaattgcaggctctattgtaaatcaagctttcttccaagaatatttaggt
atgcgtaatgaatatgtggatatgatggaaattaaacgccgtttagaccgcaaaatttat
gatcaagaagaagttgatttagccttgagttgggttaaacaatattgcaaagaaggggtt
gatgtaaatagcctagagaatcaacgcaatgcagaagagcgtgcagaactttgggaaaat
gttgtgaaaatgaccattatcactcgtgatttgatggtaggaaatccaaaattagcaaca
ttaaattatgcagaagaagccttaggccataatgccattgcagcaggttttcaagggcag
cgtcattggactgatcatttgccaaacggagattttatggaggctatgctcaattcaact
tatgactggaatggcgtgcgtccaccttatattcttgccacggaaaatgatagtttaaat
gcaataggaatgttatttgggcatcaattaactggcaaagctcaaattttcgcagatgtg
cgtacttattggagtcaagattcggttgagcgtgttactggatggcgacctgaaagtgga
ttcattcatttaatcaattcaggttcagctgcacttgatggaacaggagagcatcaagat
gctcaaggcaatccaaccttaaaaccggcatgggatgtcaccgaagaagaagcaaaacgt
tgcttagaaaatacgcgttggtgtcctgctgttcacgaatattttcgtgggggcggttta
tcttctcaattcctaaccaaaggtggcataccgtttacaatgcaccgcattaaccttatt
aaaggtctaggtcccgttctacaaattgctgaaggatggtcaatcgacctacctcaagat
gtacataataaattaaatcaacgtactaatgaaacttggccaacaacatggtttgttcca
cgtttaactggaaaaggtgcatttactgatgtgtattcagtcatggcaaattggggagca
aatcactgtgtagcgactcacggtcatgtgggggctgatctaatcactcttgcttcaatg
ttacgcattccagtctgtatgcataatgtatcagagaaaaatattttccgccctagcgct
tggaatggatttggtcaagacaaggaagggcaagattatcgagcttgccaaaactttggt
ccgctttataaataa

DBGET integrated database retrieval system