KEGG   Haemophilus influenzae 86-028NP (nontypeable): NTHI0916Help
Entry
NTHI0916          CDS       T00248                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
hit  Haemophilus influenzae 86-028NP (nontypeable)
Pathway
hit00010  Glycolysis / Gluconeogenesis
hit00260  Glycine, serine and threonine metabolism
hit00680  Methane metabolism
hit01100  Metabolic pathways
hit01110  Biosynthesis of secondary metabolites
hit01120  Microbial metabolism in diverse environments
hit01130  Biosynthesis of antibiotics
hit01200  Carbon metabolism
hit01230  Biosynthesis of amino acids
Module
hit_M00002  Glycolysis, core module involving three-carbon compounds
hit_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hit00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NTHI0916 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    NTHI0916 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NTHI0916 (gpmA)
Enzymes [BR:hit01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     NTHI0916 (gpmA)
Membrane trafficking [BR:hit04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    NTHI0916 (gpmA)
Exosome [BR:hit04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   NTHI0916 (gpmA)
  Exosomal proteins of melanoma cells
   NTHI0916 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 FMO-like
Motif
Other DBs
NCBI-ProteinID: AAX87805
UniProt: Q4QME2
Position
886840..887523
Genome map
AA seq 227 aa AA seqDB search
MELVFIRHGFSEWNAKNLFTGWRDVNLTERGVEEAKAAGKKLLDKGYEFDIAFTSVLTRA
IKTCNIVLEESHQLWIPQVKNWRLNERHYGALQGLDKKATAEQYGDEQVHIWRRSYDISP
PDLDPQDPNSAHNDRRYANIPSDVVPNAENLKLTLERALPFWEDQIAPAMLSGKRVLVVA
HGNSLRALAKHIIGISDAEIMDFEIPTGQPLVLKLDDKLNYVEHYYL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggaattagtatttatccgtcacggttttagtgaatggaatgcgaaaaacttattcaca
ggctggcgtgatgtgaatttaactgaacgtggtgtggaagaagcaaaagctgcgggtaaa
aaactgttagacaaaggttatgaatttgatatcgcatttacctctgttttaactcgagca
atcaaaacttgtaatatcgtgttagaagaatcccatcaattatggattccgcaagtaaaa
aactggcgtttaaatgaacgtcattatggtgctttacaaggtttagataaaaaagcgact
gcggagcaatacggtgacgaacaagttcatatttggcgtcgttcttatgacatttctcca
ccagatttagatccacaagatccaaattctgcacacaatgaccgtcgctacgcaaatatt
ccatctgatgttgtgccaaacgcagaaaatttaaaattaacattagaacgcgcattacca
ttctgggaagatcaaattgcaccagcaatgctttctggcaaacgtgttttagtagttgct
cacggtaattcacttcgtgcgttggcaaaacatattatcggtatttctgatgctgaaatt
atggattttgaaattccaacaggtcagcctttagttttaaaacttgatgataaattaaat
tacgtagaacattactatctttaa

DBGET integrated database retrieval system