KEGG   Haemophilus influenzae 86-028NP (nontypeable): NTHI0916Help
Entry
NTHI0916          CDS       T00248                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
hit  Haemophilus influenzae 86-028NP (nontypeable)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hit00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NTHI0916 (gpmA)
   01230 Biosynthesis of amino acids
    NTHI0916 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NTHI0916 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    NTHI0916 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NTHI0916 (gpmA)
Enzymes [BR:hit01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     NTHI0916 (gpmA)
Exosome [BR:hit04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   NTHI0916 (gpmA)
  Exosomal proteins of melanoma cells
   NTHI0916 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
886840..887523
Genome map
AA seq 227 aa AA seqDB search
MELVFIRHGFSEWNAKNLFTGWRDVNLTERGVEEAKAAGKKLLDKGYEFDIAFTSVLTRA
IKTCNIVLEESHQLWIPQVKNWRLNERHYGALQGLDKKATAEQYGDEQVHIWRRSYDISP
PDLDPQDPNSAHNDRRYANIPSDVVPNAENLKLTLERALPFWEDQIAPAMLSGKRVLVVA
HGNSLRALAKHIIGISDAEIMDFEIPTGQPLVLKLDDKLNYVEHYYL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggaattagtatttatccgtcacggttttagtgaatggaatgcgaaaaacttattcaca
ggctggcgtgatgtgaatttaactgaacgtggtgtggaagaagcaaaagctgcgggtaaa
aaactgttagacaaaggttatgaatttgatatcgcatttacctctgttttaactcgagca
atcaaaacttgtaatatcgtgttagaagaatcccatcaattatggattccgcaagtaaaa
aactggcgtttaaatgaacgtcattatggtgctttacaaggtttagataaaaaagcgact
gcggagcaatacggtgacgaacaagttcatatttggcgtcgttcttatgacatttctcca
ccagatttagatccacaagatccaaattctgcacacaatgaccgtcgctacgcaaatatt
ccatctgatgttgtgccaaacgcagaaaatttaaaattaacattagaacgcgcattacca
ttctgggaagatcaaattgcaccagcaatgctttctggcaaacgtgttttagtagttgct
cacggtaattcacttcgtgcgttggcaaaacatattatcggtatttctgatgctgaaatt
atggattttgaaattccaacaggtcagcctttagttttaaaacttgatgataaattaaat
tacgtagaacattactatctttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system