KEGG   Haemophilus influenzae 86-028NP (nontypeable): NTHI0976Help
Entry
NTHI0976          CDS       T00248                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hit  Haemophilus influenzae 86-028NP (nontypeable)
Pathway
hit00040  Pentose and glucuronate interconversions
hit00052  Galactose metabolism
hit00500  Starch and sucrose metabolism
hit00520  Amino sugar and nucleotide sugar metabolism
hit01100  Metabolic pathways
hit01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hit00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NTHI0976 (galU)
   00052 Galactose metabolism
    NTHI0976 (galU)
   00500 Starch and sucrose metabolism
    NTHI0976 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    NTHI0976 (galU)
Enzymes [BR:hit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NTHI0976 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 CoA_binding
Motif
Other DBs
NCBI-ProteinID: AAX87859
UniProt: Q4QM88
Position
complement(927755..928642)
Genome map
AA seq 295 aa AA seqDB search
MKAIIPVAGLGTRMLPATKAIPKEMLTLVDKPLIQYVVNECVAAGIKEIVLVTHSSKNAI
ENHFDTSFELETMLEKRVKRQLLEEVRSICPKNVTIMHVRQGNAKGLGHAVLCGRPLVGN
ESFAVMLPDVLLAEFSADQKKENLAAMIQRFNETGASQIMVTPVPQENVSSYGVADCGGI
ELNGGESAKINSIVEKPSIEDAPSNLAVVGRYVFSAAIWDLLEKTPIGVGDEIQLTDAID
MLIEKETVEAFHMTGETFDCGDKIGYMEAFVEYGIRHEKLGKEFKSFIKNLAKTL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaattattcctgtcgccggtcttggcacacgtatgttgcccgccacgaaggcg
attccgaaggaaatgctcactttggtggataaaccgttaattcaatacgtggtaaatgaa
tgtgtagctgctggcataaaagaaattgtgctggtaacacattcatcaaaaaatgctatc
gaaaaccattttgatacatcttttgaattagaaacaatgctggaaaaacgtgtgaagcgt
cagcttctagaagaagttcgttctatctgtccaaaaaatgtaaccattatgcacgttcgt
caaggtaatgcgaaaggtttaggtcacgccgtgttatgcggtcgtcctttagtaggaaat
gaatcttttgccgttatgttaccagatgtattattagctgaatttagtgcagatcagaaa
aaagaaaatcttgctgcaatgattcaacgctttaatgaaactggcgcaagccaaattatg
gtaaccccagttccgcaagaaaatgtgagtagctatggtgttgcagattgtggtggcatt
gagcttaatggcggcgaaagtgcaaaaattaatagtattgttgaaaaaccttctattgaa
gacgcaccatcaaatcttgctgtggttgggcgttatgttttttcagcagcaatttgggat
ttgttagaaaaaacaccaattggtgttggcgatgaaatccaattaaccgatgctattgat
atgctcattgaaaaagaaaccgttgaagcatttcatatgacaggggaaacttttgattgt
ggcgataaaattggttatatggaagctttcgtagaatatggtattcgtcacgaaaaatta
ggtaaagaatttaaatcctttatcaaaaatttggcaaaaacgctataa

DBGET integrated database retrieval system