KEGG   Haemophilus influenzae 86-028NP (nontypeable): NTHI1154Help
Entry
NTHI1154          CDS       T00248                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hit  Haemophilus influenzae 86-028NP (nontypeable)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:hit00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NTHI1154 (pfkA)
   01230 Biosynthesis of amino acids
    NTHI1154 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NTHI1154 (pfkA)
   00030 Pentose phosphate pathway
    NTHI1154 (pfkA)
   00051 Fructose and mannose metabolism
    NTHI1154 (pfkA)
   00052 Galactose metabolism
    NTHI1154 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    NTHI1154 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    NTHI1154 (pfkA)
Enzymes [BR:hit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     NTHI1154 (pfkA)
Protein phosphatases and associated proteins [BR:hit01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     NTHI1154 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1095958..1096923)
Genome map
AA seq 321 aa AA seqDB search
MIKKIAVLTSGGDAPGMNAAIRGVVRSALAEGLEVFGIYDGYQGLYNNKIKQLNRYSVSD
VINRGGTFLGSARFPEFKDPNVRAKCAEILRSHGIDALVVIGGDGSYMGAKLLTEEHGFP
CVGLPGTIDNDVAGTDYTIGYQTALQTAVDAIDRLRDTSSSHQRISIVEIMGRHCSDLTI
SAGIAGGCEYIVASEIEFNREELIQQIERSIIRGKRHAIIAITELLTDVHSLAKEIEARV
GHETRATVLGHIQRGGSPCAFDRILASRMGAYAVDLLLQGKGGYCVGIQNEQLVHHDIID
AINNMQRVFKADWLKVAKRLE
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaattgcagttttaacaagtggtggcgatgcgccgggtatgaatgccgca
attcgtggcgtagtacgctctgcacttgcagaaggcttagaagtgtttggtatctatgat
ggttaccaaggtttatacaataataaaatcaaacaattaaatcgctatagcgtatctgat
gtaattaatcgtggcggtacttttttaggttctgcacgctttcctgaatttaaagatcca
aatgttcgtgcaaaatgtgcagaaattttacgttctcacggcattgatgcacttgtggtt
atcggtggtgacggttcttatatgggagctaaattattaaccgaagaacacggtttccct
tgtgttggcttacccggtactattgataatgatgttgcaggtactgactataccatcggc
tatcaaaccgcattacaaactgcagtggatgcaatcgaccgtttacgtgatacatcaagc
tcacaccaacgtatttctatcgttgaaattatgggtcgccattgtagtgacttaacgatt
tctgcgggcattgctggcggttgtgaatatatcgtcgcatcagaaattgaatttaatcgc
gaagaattaattcaacaaattgaacgtagcattattcgcggtaaacgccacgctattatt
gctatcactgaacttttaactgatgttcattctctggcaaaagaaattgaagctcgcgta
ggtcacgaaactcgcgcaaccgttttagggcatattcaacgtggtggttctccttgtgct
tttgaccgtattcttgcctcacgtatgggcgcatacgcagtagatttattgctacaaggc
aaaggcggctattgcgtaggtatccaaaatgaacaactcgttcatcacgatattattgat
gccattaataatatgcagcgtgtatttaaggctgattggcttaaagtggcaaaacgtttg
gaataa

DBGET integrated database retrieval system