KEGG   Haemophilus influenzae 86-028NP (nontypeable): NTHI1154Help
Entry
NTHI1154          CDS       T00248                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hit  Haemophilus influenzae 86-028NP (nontypeable)
Pathway
hit00010  Glycolysis / Gluconeogenesis
hit00030  Pentose phosphate pathway
hit00051  Fructose and mannose metabolism
hit00052  Galactose metabolism
hit00680  Methane metabolism
hit01100  Metabolic pathways
hit01110  Biosynthesis of secondary metabolites
hit01120  Microbial metabolism in diverse environments
hit01130  Biosynthesis of antibiotics
hit01200  Carbon metabolism
hit01230  Biosynthesis of amino acids
hit03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:hit00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NTHI1154 (pfkA)
   00030 Pentose phosphate pathway
    NTHI1154 (pfkA)
   00051 Fructose and mannose metabolism
    NTHI1154 (pfkA)
   00052 Galactose metabolism
    NTHI1154 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    NTHI1154 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    NTHI1154 (pfkA)
Enzymes [BR:hit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     NTHI1154 (pfkA)
Protein phosphatases and associated proteins [BR:hit01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     NTHI1154 (pfkA)
Messenger RNA biogenesis [BR:hit03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     NTHI1154 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AAX88019
UniProt: Q4QLS8
Position
complement(1095958..1096923)
Genome map
AA seq 321 aa AA seqDB search
MIKKIAVLTSGGDAPGMNAAIRGVVRSALAEGLEVFGIYDGYQGLYNNKIKQLNRYSVSD
VINRGGTFLGSARFPEFKDPNVRAKCAEILRSHGIDALVVIGGDGSYMGAKLLTEEHGFP
CVGLPGTIDNDVAGTDYTIGYQTALQTAVDAIDRLRDTSSSHQRISIVEIMGRHCSDLTI
SAGIAGGCEYIVASEIEFNREELIQQIERSIIRGKRHAIIAITELLTDVHSLAKEIEARV
GHETRATVLGHIQRGGSPCAFDRILASRMGAYAVDLLLQGKGGYCVGIQNEQLVHHDIID
AINNMQRVFKADWLKVAKRLE
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaattgcagttttaacaagtggtggcgatgcgccgggtatgaatgccgca
attcgtggcgtagtacgctctgcacttgcagaaggcttagaagtgtttggtatctatgat
ggttaccaaggtttatacaataataaaatcaaacaattaaatcgctatagcgtatctgat
gtaattaatcgtggcggtacttttttaggttctgcacgctttcctgaatttaaagatcca
aatgttcgtgcaaaatgtgcagaaattttacgttctcacggcattgatgcacttgtggtt
atcggtggtgacggttcttatatgggagctaaattattaaccgaagaacacggtttccct
tgtgttggcttacccggtactattgataatgatgttgcaggtactgactataccatcggc
tatcaaaccgcattacaaactgcagtggatgcaatcgaccgtttacgtgatacatcaagc
tcacaccaacgtatttctatcgttgaaattatgggtcgccattgtagtgacttaacgatt
tctgcgggcattgctggcggttgtgaatatatcgtcgcatcagaaattgaatttaatcgc
gaagaattaattcaacaaattgaacgtagcattattcgcggtaaacgccacgctattatt
gctatcactgaacttttaactgatgttcattctctggcaaaagaaattgaagctcgcgta
ggtcacgaaactcgcgcaaccgttttagggcatattcaacgtggtggttctccttgtgct
tttgaccgtattcttgcctcacgtatgggcgcatacgcagtagatttattgctacaaggc
aaaggcggctattgcgtaggtatccaaaatgaacaactcgttcatcacgatattattgat
gccattaataatatgcagcgtgtatttaaggctgattggcttaaagtggcaaaacgtttg
gaataa

DBGET integrated database retrieval system