KEGG   Haemophilus influenzae 86-028NP (nontypeable): NTHI1216Help
Entry
NTHI1216          CDS       T00248                                 

Gene name
res
Definition
type III restriction-modification system HindVIP enzyme res (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
hit  Haemophilus influenzae 86-028NP (nontypeable)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1158124..1160289)
Genome map
AA seq 721 aa AA seqDB search
MANNKTLFDWVEDRKSMLEEMEQTDFFALPEFVSNNLKYPFFEWQKSALENFVIFDRTPK
LKDFPDIKNRPTHLLFNMATGAGKTMMMAALILYYFEKGYRHFLFFVNQNNIVDKTENNF
TDPTHAKFLFTEKILQGDTVIPIRKVETFSPHSDGIEIKFTSIQKLYNDIRTRRENQTTL
ADLHKLNLVMLGDEAHHLNAQTKGKKQGELDLEKEMNDRTSNAEIERKGWEHMVLELLLN
KNGNHSQNVLLEFTATLPENADVQQKYADKIITKFGLKEFLQKGYTKEINLVSSTLGKKE
RVLHALLFAWYRHRIALKYGIANFKPVMLFRSKTIDESKADYLAFLNWAENVQAVDFSFL
TTFSTSLNDSDSDNANEQGKTRTEQALKFMQEKGVEFAHLADWVKQNYQKHNVIITNSES
NKTKTEKTDSETEKLLNNLEAADNPIRAIFTVDRLTEGWDVLNLFDIVRLYEGQNGGGSN
KKSGKTAAATVSEKQLIGRGVRYFPFAFEDKQPNKRKFDNDMQHELRILEELFYYTHDEQ
SRYISELKAELRKDGFIPENDKDKVLTTFKLKSEFADDETFKNLLIWANQKVKNPNAKAN
NADSLKANPQTLSFQIHGNQLLQETQFTADENDETARQIGTQNNFTQTIKMSEMERHIFN
KALHIKGKNSQSLFHFDRLQSKLNIQNRNELQNNLLKDWQIEFLGLGQDKQISPDDNLQA
A
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atggcgaataataaaacgttgtttgattgggtggaagaccgcaaatcaatgctggaagaa
atggaacagacagattttttcgcactgcctgaatttgtttcaaataatttgaaatatccg
ttttttgaatggcagaaatcggctttagaaaactttgtaatttttgaccgcactccaaaa
ttaaaggacttccccgatatcaaaaaccgccctacccatttgctatttaatatggcaaca
ggtgcaggcaaaacgatgatgatggcagcgttgattttgtattattttgaaaaagggtat
cggcattttctgttttttgtgaatcaaaacaatatcgtggataaaacggaaaataatttt
accgatccgacgcacgcaaaatttttatttaccgagaagattttgcagggcgatacggta
attcctattcgcaaagtggagacatttagcccacattcagacggcattgaaattaaattt
accagcattcaaaagctgtataacgatattcgcacccggcgggaaaatcaaaccacattg
gcggatttgcacaaattgaaccttgtgatgctgggtgatgaagcgcaccatttaaacgcg
caaaccaaaggcaaaaaacaaggcgaattagatttagaaaaggaaatgaacgaccgcacc
agcaatgccgaaattgaacgtaaaggctgggagcatatggttttggaattgttactcaat
aaaaatggcaatcatagccaaaatgtgctgttggaatttaccgccacgctgcctgaaaat
gctgacgtgcaacaaaagtacgctgataaaatcatcacaaaatttggcttaaaagaattt
ttgcaaaaaggttataccaaagaaatcaatttggtatccagtacgctgggtaagaaagag
cgagtgttacacgctttattgtttgcttggtatcgacatcgaattgcgttgaaatatggc
attgccaatttcaagcctgtgatgttgtttagaagtaagacgattgatgaatcaaaagcg
gattatctggcatttttaaattgggcagaaaatgtgcaggcggttgatttttcgttttta
actacattttcaacaagcttgaacgatagcgatagcgataacgccaacgaacaaggcaaa
acccgcactgaacaagccctaaaatttatgcaggaaaaaggcgttgagtttgcacatttg
gcagattgggtaaaacaaaattatcaaaaacacaatgtgattattaccaactccgagagc
aacaaaaccaaaaccgaaaaaaccgacagcgaaaccgaaaaattgctaaataatttggaa
gcggccgataatccgatccgtgccatttttacggtggacagattaaccgaaggttgggac
gttctgaatttgtttgatattgtgcgtttatatgaagggcaaaacggcggcggttcaaat
aaaaaatcaggcaaaacggctgccgccaccgtatcggaaaagcagttgattggtcgtggc
gtgcgttattttccatttgcgtttgaagataaacagccgaataaacgcaaatttgacaat
gacatgcaacacgaattgcgtattttggaagaattgttttattacacgcacgatgagcaa
tctcgctatatttcagaattaaaagcagaacttcgcaaagatggctttattcccgaaaac
gataaagacaaggttttaaccaccttcaaactaaaatctgaatttgcagatgatgaaact
tttaaaaacctattgatttgggcaaatcaaaaagtaaaaaatcccaatgctaaagccaat
aatgcagacagcctaaaagccaatccgcaaacgctttcattccaaattcacggcaatcaa
ttgttgcaggaaacgcaatttacagccgatgaaaatgatgaaaccgcccgacaaatcggc
acacaaaataattttactcaaaccataaaaatgagtgaaatggagcggcacatttttaat
aaagccttgcatatcaaaggaaaaaatagtcaatctttatttcatttcgatcgcttgcaa
agcaaactcaacattcaaaatcgcaatgaattgcaaaataacttgttaaaagattggcaa
attgaatttttgggattagggcaagataaacagattagcccagatgacaacttgcaggct
gcctaa

DBGET integrated database retrieval system