KEGG   Haemophilus influenzae 86-028NP (nontypeable): NTHI1384Help
Entry
NTHI1384          CDS       T00248                                 

Gene name
dsbC
Definition
thiol-disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hit  Haemophilus influenzae 86-028NP (nontypeable)
Brite
Enzymes [BR:hit01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     NTHI1384 (dsbC)
Secretion system [BR:hit02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   NTHI1384 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1313427..1314116
Genome map
AA seq 229 aa AA seqDB search
MKKIFTALLCVAAANAMADDAAIKRKLQSFNVSNIAIKSSPISGIRTAVTDQGILYVSED
GKYLFEGKLYELTNNGPVDVAGKILVDKLNSYKDEMIVYPAKNEKHVVTVFMDITCHYCH
LLHQQLKEYNDLGITVRYLAFPRAGMNNQTAKQMEAIWTAKDPVFALNEAEKGNLPKEVK
TPNIVKKHYELGIQFSVRGTPSIVTSTGELIGGYLKPADLLRALEETAQ
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatttttaccgcacttttgtgcgtggctgcggctaatgcaatggcagatgat
gcggcaattaaacgcaaattacagtcttttaatgtgtcaaatattgctattaaatcttcg
ccgatttcaggcattagaacggctgtcacggatcaaggtatactttatgtgagcgaagat
ggaaaatatctttttgaaggtaaactttatgaactcacaaataatggccctgttgatgta
gcaggtaaaattttagtagataaacttaattcttataaagacgagatgattgtttatcct
gcgaaaaatgaaaaacacgtagtaacagtatttatggatattacctgccattattgccat
ttgttacatcagcaattaaaagaatataacgatcttggtattactgtgcgttatttagct
ttccctcgtgcaggtatgaataatcaaacggcgaaacaaatggaagcgatttggacggcg
aaagatcctgtttttgctttaaacgaagctgaaaaaggcaatttaccgaaagaagttaaa
acgccaaatatcgtgaaaaaacattatgaattaggtattcaatttagtgtacgaggaaca
ccaagtattgttacctcaactggtgagcttattggcggttatttaaaaccagctgattta
ttaagagctcttgaagaaacggcacaataa

DBGET integrated database retrieval system