KEGG   Haemophilus influenzae 86-028NP (nontypeable): NTHI1640Help
Entry
NTHI1640          CDS       T00248                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
hit  Haemophilus influenzae 86-028NP (nontypeable)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hit00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NTHI1640
Enzymes [BR:hit01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     NTHI1640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1523450..1524262
Genome map
AA seq 270 aa AA seqDB search
MKTTLLKTLTPELHLVQHNDIPILYLKHAVGTAKISLQGAQLISWKPQNAKQDVLWLSEV
EPFKNGNAIRGGVPICYPWFGGVKQPAHGTARIRLWQLSHYDISAHKVRLEFELFSDLNI
IEAKIAMVFTDKCHLTFTHYGEESAQAALHTYFNIGDINQVEVQGLPETCFNSLNQQQEN
VPSPRHISENVDCVYSAENMQNQILDKSFNRTIALHHHNASQFVLWNPWHKKTSGMSETG
YQTMLCLETARIHHLLEFGESLSVEISLKG
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaacattactaaaaacactgacaccagaacttcatcttgttcaacataatgat
attcccattctttatctaaaacacgctgttggaacagcaaaaatttccctgcaaggggca
cagcttatcagttggaaaccgcaaaatgcgaagcaagatgtattatggctaagtgaagta
gagccattcaaaaatggcaatgctattcgtggtggtgtaccgatttgctatccttggttt
ggtggcgtaaaacaacctgcgcacggcacagctcgtattcgtttatggcagttaagccat
tatgatatttcagcccataaagtgcggttagaatttgagttgttttctgatttaaatatt
atcgaagcgaaaattgctatggtatttacagacaaatgtcatttaacttttacccattat
ggcgaagaatcagcccaagcagcattacatacctattttaatattggggatattaatcaa
gtggaagtacaaggtttacctgaaacttgttttaatagcttaaaccaacaacaagaaaat
gttccgtcaccgcgtcacatttctgaaaatgttgattgcgtttattccgcagaaaacatg
cagaatcaaatcctagataaaagtttcaatcgtacaattgcactgcatcatcataatgca
agtcaatttgtcctttggaatccttggcacaaaaagacgagtggaatgagtgaaactggc
tatcaaacgatgttgtgcttagaaactgcacgcattcatcacttacttgaatttggcgaa
agtttaagcgtggaaatttcgcttaaaggctaa

DBGET integrated database retrieval system