KEGG   Haemophilus influenzae 86-028NP (nontypeable): NTHI1646Help
Entry
NTHI1646          CDS       T00248                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
hit  Haemophilus influenzae 86-028NP (nontypeable)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hit00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NTHI1646 (recD)
Enzymes [BR:hit01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     NTHI1646 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1529512..1531434
Genome map
AA seq 640 aa AA seqDB search
MLSVLHKLKEQRILSQGDYYFAKLIADKQCHTDYAEPIKNLAILLAALCSWRYTQGNTCS
QLDRYLEHNLFGLAYRTTEEDYLAEIREKIGYLAVEDWQNALCGHMAFTQDPVNQIAPMV
FQFGALYFYRTWQDEYRIAQYIKNTLKKHRTLAFSYDEIHQKLEKYFPEKQEKTDWQKVA
VATAIKSPFSIITGGPGTGKTTTVTRLLLVLQELFDCKLHIKLVAPTGKAASRLEESIKN
ALGFMQEKMNVSHSLFNAIPQKASTLHSLLGVNAFNDYTRYNSHNPLQLDVLVVDETSMI
DLPMMVKLINALKPETRLILLGDQAQLASVEAGAVLGELAQFVTQPYSHEQVAYLLATTG
YKVEGSDCSNPIRDCLCHLTESRRFDKDSGIGKLAEFIQKGKADDSLELFDHYPQELHFN
ALNDESDAVNQVVKSAVENYRTFLKMLDDLRKQKIDPNAKNEQGISYAEAIQAQFNSVRF
LTALRNNNLGVENLNKEIALALREQKLLWFRNEQDWYIGKPIMITENDHNVRLYNGDIGL
CLANGKVWFGNREVLTNRIPAHEPAFMMTIHKSQGSEFEHTVMVLPTEVNPVLSRELVFT
GVTRAKKELTVFADEKIWKTAIRQTVKRQSGLGKLLEDLN
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgttatctgtattacacaaacttaaagagcagcgcattctttctcaaggtgattattat
tttgctaagttgatagctgataaacaatgtcatacggattatgcggaaccaatcaaaaat
ttagctatattattagccgcactttgtagttggcgttatacgcagggaaatacttgcagc
caattagatcgctatttagaacataatttatttggcttggcttatcgcactacagaagaa
gactatttagctgaaattcgtgaaaagattggttatttagctgtggaagattggcaaaat
gcgttgtgcgggcatatggcatttacgcaagatcccgtcaatcaaattgcaccaatggta
tttcaatttggcgcgttgtatttctatcgtacttggcaagatgaatatcgtatcgcgcaa
tatataaaaaacactttaaaaaaacaccgcactttagccttttcttatgatgaaattcat
caaaaattagagaaatatttccctgaaaaacaggaaaaaacagattggcaaaaagtggca
gtggcgacagcgattaaaagtccattttcgattattacgggtggcccaggaacaggaaaa
accacgacagttacgcgtttattgctcgttctacaagaattatttgattgtaaattacac
atcaaattggttgcaccgactggcaaagccgcctcccgtttggaagagtcgattaaaaat
gcgttaggttttatgcaagaaaaaatgaatgtatcccattcacttttcaatgcgattcca
caaaaagccagcaccttgcatagtttactgggcgtgaacgcctttaatgattacacgcgc
tataacagccataaccctttgcaattagatgtgttagttgtcgatgaaacatcaatgatt
gatttgccgatgatggtaaaacttatcaatgcgttaaagcccgaaacccgattaatttta
ttaggcgatcaggcacaattagcctctgttgaggcgggggctgtattgggggaattagct
caatttgttactcaaccttatagtcatgaacaagtcgcatacttactagcaacaacaggc
tacaaagtagaaggttccgattgttcaaatccaatacgtgattgcttatgccatctaaca
gaaagtcgccgttttgataaagattcaggcattggaaaattggctgaattcattcaaaaa
ggcaaagcagacgatagccttgagttatttgaccattatccgcaagaattgcactttaat
gccctaaatgatgaaagcgatgcggtcaatcaagtggtgaaaagtgcggtggaaaattac
cgcactttcttaaaaatgttggacgatttacgtaaacaaaaaattgatcctaacgctaaa
aatgaacaaggcatttcctatgccgaagccattcaagcgcaatttaattctgtgagattt
ttaaccgcacttcgtaataacaatttaggtgtcgaaaatctcaataaagaaattgcgtta
gcgttgcgagagcaaaaattgctttggttccgtaatgaacaagattggtatatcggcaag
ccaattatgattactgaaaatgatcataacgttcgcctttataacggcgatattggacta
tgcttggcaaatggcaaagtatggtttggcaatcgagaagtgctgacaaaccgaattcca
gcgcacgaacccgcttttatgatgacgattcataaatctcaaggttccgaatttgaacac
actgtcatggtgcttccaacagaagtaaatccagtactgtcgcgagaattagttttcacg
ggcgtcactcgtgcgaaaaaagaactcactgtatttgccgatgaaaaaatatggaaaaca
gcgattcgtcagaccgtcaaacgccagagcggattgggaaaattattggaagatttaaat
tag

DBGET integrated database retrieval system