KEGG   Haemophilus influenzae 86-028NP (nontypeable): NTHI1663Help
Entry
NTHI1663          CDS       T00248                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hit  Haemophilus influenzae 86-028NP (nontypeable)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hit00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1542111..1542941
Genome map
AA seq 276 aa AA seqDB search
MKLYANNKCLDLSVPKIMGILNFTPDSFSDSGQFFSLDKALFQVEKMLEEGATIIDIGGE
STRPNDADEVSEQEELHRVVPVVEAVRSRFDCWISVDSSKAVVMREAASVGMDLINDIRA
LQEPNALETAVKLALPVCIMHMQGQPRTMQANPHYENVVQDVFAFLQKRTNECLSAGVKK
ENLIWDMGFCFGKSVQHNYQLLQNLNEFCHSGYPVLAGLSRKSMIGAVLDKPVDQRVIGS
AAGALIAAQKGAKILRVHDVAATSDMLKVWQATENA
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaaactttacgcaaataataaatgtcttgatttaagcgttcctaagattatgggaatc
cttaattttacgcctgattctttttctgatagcggacagttttttagtttggataaagcg
ctttttcaagttgaaaaaatgttggaagaaggggcgacaattattgatattggtggtgaa
tctacgcgtcctaatgatgcggatgaagtctctgaacaagaagaattgcatcgtgttgtg
ccagtagtggaggcggtgcgaagccgttttgattgctggatttctgtcgattcttcaaaa
gcagttgtgatgcgtgaagcagcaagtgttggaatggatttgattaatgatattcgtgct
ttgcaagagccaaatgcgttagaaaccgcagtaaaactagctttacctgtttgtatcatg
catatgcaagggcaacctagaacgatgcaggcaaatcctcattatgagaatgtcgtacaa
gatgtattcgcttttttacagaaacgtactaatgaatgtctttctgctggtgttaaaaaa
gaaaacttaatttgggacatgggattttgttttggtaagtctgtacagcataattatcaa
ttattacaaaatctgaatgaattttgtcatagtggatatcctgtgttagcgggattatct
cgcaaatcaatgattggtgcggtgcttgataaacccgtcgatcagagagtgataggtagt
gcggcaggtgcgcttattgcagcgcaaaaaggtgcaaaaattttacgcgtacatgatgtt
gctgcaacatcagatatgctcaaagtttggcaggcaacagaaaatgcctga

DBGET integrated database retrieval system