KEGG   Haemophilus influenzae 86-028NP (nontypeable): NTHI1701Help
Entry
NTHI1701          CDS       T00248                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hit  Haemophilus influenzae 86-028NP (nontypeable)
Pathway
hit00260  Glycine, serine and threonine metabolism
hit00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hit01100  Metabolic pathways
hit01110  Biosynthesis of secondary metabolites
hit01130  Biosynthesis of antibiotics
hit01230  Biosynthesis of amino acids
Module
hit_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hit00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NTHI1701 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NTHI1701 (trpA)
Enzymes [BR:hit01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NTHI1701 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: AAX88491
UniProt: Q4QKF6
Position
complement(1568109..1568915)
Genome map
AA seq 268 aa AA seqDB search
MSRFETQFATLNAKNEGAFVPFVTLCDPTFDCSFEIICTLVDNGADALELGFPFSDPLLD
GPVIQAANNRALTAGHSSEDSFKLLEKVRSKYPEIPISLLLCANLIFAKGLDAFYQRCAE
VGVDAVLVADIPLLAKEDYVQAAKKHGIQPVFICPPNADEKTIQGVAKNSEGYTYLVSRA
GVTSAENQAHAANLDTLVEQLKAHYAPPILQGFGIAQPAQVKEALALGAAGAISGSATVK
IIERNLDNHEQCLAELAEFVQTMKAATK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagccgttttgaaacgcaatttgcgacacttaacgcaaaaaatgaaggggctttcgtg
ccgttcgttaccctttgcgaccctactttcgactgctcttttgagatcatttgcacactt
gtggataacggtgcagatgctttagaactcggttttcctttttccgatccgctactcgat
ggcccagttattcaagccgcgaataatcgtgctttaactgcaggtcatagcagtgaagat
agctttaaactattggaaaaagtgcggtcaaaatatcccgagattccgattagcttatta
ctttgtgccaatttaatttttgctaaaggtttagatgctttttatcaacgctgtgcagaa
gttggtgttgatgctgtgcttgtagcagatattccgttactcgcaaaagaagattatgta
caagcggccaaaaaacacggcattcaacccgtctttatttgcccgccaaatgcggatgag
aaaacaattcaaggcgtagcgaaaaatagcgaaggctatacctatttagtctcacgtgca
ggcgtaaccagtgctgaaaatcaagctcacgcagcaaatttagatacccttgtagaacaa
cttaaagcccactatgccccgccaattttacaaggcttcggcattgcacagcctgcacaa
gttaaagaagccttagctttgggagcggctggtgcaatttcaggttcggcaacagtaaaa
attattgagcgaaatttagataatcacgagcaatgtttagctgaattagctgaatttgtt
caaacgatgaaagctgcaacaaaataa

DBGET integrated database retrieval system