KEGG   Haemophilus influenzae 86-028NP (nontypeable): NTHI1753Help
Entry
NTHI1753          CDS       T00248                                 

Gene name
holC
Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
hit  Haemophilus influenzae 86-028NP (nontypeable)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:hit00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NTHI1753 (holC)
   00240 Pyrimidine metabolism
    NTHI1753 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    NTHI1753 (holC)
   03430 Mismatch repair
    NTHI1753 (holC)
   03440 Homologous recombination
    NTHI1753 (holC)
Enzymes [BR:hit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     NTHI1753 (holC)
DNA replication proteins [BR:hit03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     NTHI1753 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1603831..1604265
Genome map
AA seq 144 aa AA seqDB search
MAKTAQFYILTENCTLTVEEIACNLAASIWRSGKKVLISCESESQALEIDELLWQRDPNE
FVPHNLSGEATQYPTPIEISWLGKRNLQHRDLLINLQQEIPDFSHSFTQIIDFVPKDDAL
KTQARERYKQLRLQGWNLSTENVG
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaactgcacaattttatattcttacggaaaattgtactttaactgtcgaagaa
atagcctgtaatcttgctgcttcaatatggcgttcagggaaaaaagtactaattagttgc
gaaagtgagagccaagcattagaaattgatgaacttttgtggcaacgagatcccaatgaa
tttgttccgcataatttatcaggtgaggcaacacaatatcccacaccgattgagatttcg
tggcttggaaaacgaaatttacaacaccgcgatttgttaatcaatttgcaacaagaaatc
ccagattttagccatagttttacccaaattattgattttgtgccgaaagatgatgcgtta
aaaacacaagctcgagaacgttataaacaattacgtctgcaaggttggaatctttctact
gaaaacgtgggttaa

DBGET integrated database retrieval system