KEGG   Haemophilus influenzae 86-028NP (nontypeable): NTHI1763Help
Entry
NTHI1763          CDS       T00248                                 

Gene name
trpC
Definition
bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase (EC:4.1.1.48 5.3.1.24)
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
hit  Haemophilus influenzae 86-028NP (nontypeable)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hit00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NTHI1763 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NTHI1763 (trpC)
Enzymes [BR:hit01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     NTHI1763 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     NTHI1763 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1609234..1610667)
Genome map
AA seq 477 aa AA seqDB search
MMITQDFTKPIDSATVLQKIVLDKAQWVKAKEKEFPLSQFKQNIQNSDRSFYDALAKGTH
QKPAYILECKKASPSKGLIRAEFNLEEIANVYKHYASAVSVLTDEKYFQGNFEFLPLVRG
IVSQPVLCKDFMISEYQVYLARYYQADAILLMLSVVNDETYRVLAELAHSLGMGVLTETS
NEEEFERALALGAKIIGVNNRNLHDLTVDLNRVVKLTEKYADRIPADVRIISESGIYNHK
QIHQLQKVAHGFLIGSSLMGNQDLNNAVRSVIFGENKVCGLTRTQDVKIVYENGALYGGL
IFVEHSKRCVSLRQAQELVTAAPLRFVGVFQNQEIDFIVKIANQLQLYAVQLHGAETEAF
ITALRQQLPKNTQIWKAISVNTEAQSTVDFTDDLNVDRYIFDSQTANQQGGTGKTFDWSL
IPEHLKHKIILAGGISPNNVEQAIQQNCLGLDLNSGVESSVGVKDQEKVRLVFNNIY
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgatgatcactcaagattttaccaaacccattgattccgctacggtgctacaaaaaatc
gtgcttgataaagcacaatgggttaaagcaaaagaaaaggaatttcccctttcacaattt
aaacaaaacattcaaaactctgaccgctctttttatgatgcgttagcaaaaggtacgcat
caaaagcccgcttacattttggaatgtaaaaaagcctccccttctaagggattaattcgt
gctgaatttaatttggaagaaatcgccaatgtctataaacattatgcctctgctgtatct
gttctgacagatgaaaaatacttccaaggcaattttgagttcttgccgttagttcgcggt
atcgtgagccaacctgtgctttgcaaagattttatgattagcgaatatcaagtttacctt
gctcgctactatcaagcggatgcgattttattaatgctttctgtggtaaatgatgaaact
tatcgtgtgctggcagagcttgcacattctcttggcatgggcgtattgacagaaaccagc
aatgaagaagaatttgaacgcgcccttgcgcttggtgcgaaaatcattggtgttaataat
cgtaacttgcacgatttaactgtggatttaaatcgtgttgttaaactcactgaaaaatac
gccgaccgaatccctgctgatgtacgtattattagcgaatcaggcatttacaatcacaag
caaattcatcaattacaaaaggtggcgcatggtttcttaattgggagtagcttaatgggc
aaccaagatttgaataatgcggttcgctcggtgatttttggagaaaataaagtatgcggt
ttaacacgcacgcaagatgtcaaaatcgtttacgaaaacggggcactttacggcggatta
atcttcgtagaacattcaaaacgttgtgtgagtttacgccaagcgcaagaattagtaacc
gctgcgccacttcgatttgttggtgtttttcagaatcaagaaattgactttatcgtcaaa
atagccaaccagttgcagctttatgcggtgcaattacatggtgcagaaactgaagcattt
attaccgcacttcgccagcaactaccaaaaaacacgcaaatctggaaagcgatttcggtc
aatactgaagcccaaagtacggtcgattttaccgatgatttgaatgtggatcgttatatt
tttgacagccagacagcgaaccaacaaggcggcacgggtaaaacctttgattggtcatta
attcccgaacatcttaagcacaagattattttagctggaggtatctcgccaaataatgta
gaacaagccattcaacaaaattgcttaggcttggatcttaattcaggagtagaaagttct
gtgggcgtaaaagatcaagaaaaagtacggttagtttttaataatatttattaa

DBGET integrated database retrieval system