KEGG   Haemophilus influenzae 86-028NP (nontypeable): NTHI1763Help
Entry
NTHI1763          CDS       T00248                                 

Gene name
trpC
Definition
(GenBank) tryptophan biosynthesis protein trpCF
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
hit  Haemophilus influenzae 86-028NP (nontypeable)
Pathway
hit00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hit01100  Metabolic pathways
hit01110  Biosynthesis of secondary metabolites
hit01130  Biosynthesis of antibiotics
hit01230  Biosynthesis of amino acids
Module
hit_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hit00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NTHI1763 (trpC)
Enzymes [BR:hit01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     NTHI1763 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     NTHI1763 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AAX88545
UniProt: Q4QKA2
Position
complement(1609234..1610667)
Genome map
AA seq 477 aa AA seqDB search
MMITQDFTKPIDSATVLQKIVLDKAQWVKAKEKEFPLSQFKQNIQNSDRSFYDALAKGTH
QKPAYILECKKASPSKGLIRAEFNLEEIANVYKHYASAVSVLTDEKYFQGNFEFLPLVRG
IVSQPVLCKDFMISEYQVYLARYYQADAILLMLSVVNDETYRVLAELAHSLGMGVLTETS
NEEEFERALALGAKIIGVNNRNLHDLTVDLNRVVKLTEKYADRIPADVRIISESGIYNHK
QIHQLQKVAHGFLIGSSLMGNQDLNNAVRSVIFGENKVCGLTRTQDVKIVYENGALYGGL
IFVEHSKRCVSLRQAQELVTAAPLRFVGVFQNQEIDFIVKIANQLQLYAVQLHGAETEAF
ITALRQQLPKNTQIWKAISVNTEAQSTVDFTDDLNVDRYIFDSQTANQQGGTGKTFDWSL
IPEHLKHKIILAGGISPNNVEQAIQQNCLGLDLNSGVESSVGVKDQEKVRLVFNNIY
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgatgatcactcaagattttaccaaacccattgattccgctacggtgctacaaaaaatc
gtgcttgataaagcacaatgggttaaagcaaaagaaaaggaatttcccctttcacaattt
aaacaaaacattcaaaactctgaccgctctttttatgatgcgttagcaaaaggtacgcat
caaaagcccgcttacattttggaatgtaaaaaagcctccccttctaagggattaattcgt
gctgaatttaatttggaagaaatcgccaatgtctataaacattatgcctctgctgtatct
gttctgacagatgaaaaatacttccaaggcaattttgagttcttgccgttagttcgcggt
atcgtgagccaacctgtgctttgcaaagattttatgattagcgaatatcaagtttacctt
gctcgctactatcaagcggatgcgattttattaatgctttctgtggtaaatgatgaaact
tatcgtgtgctggcagagcttgcacattctcttggcatgggcgtattgacagaaaccagc
aatgaagaagaatttgaacgcgcccttgcgcttggtgcgaaaatcattggtgttaataat
cgtaacttgcacgatttaactgtggatttaaatcgtgttgttaaactcactgaaaaatac
gccgaccgaatccctgctgatgtacgtattattagcgaatcaggcatttacaatcacaag
caaattcatcaattacaaaaggtggcgcatggtttcttaattgggagtagcttaatgggc
aaccaagatttgaataatgcggttcgctcggtgatttttggagaaaataaagtatgcggt
ttaacacgcacgcaagatgtcaaaatcgtttacgaaaacggggcactttacggcggatta
atcttcgtagaacattcaaaacgttgtgtgagtttacgccaagcgcaagaattagtaacc
gctgcgccacttcgatttgttggtgtttttcagaatcaagaaattgactttatcgtcaaa
atagccaaccagttgcagctttatgcggtgcaattacatggtgcagaaactgaagcattt
attaccgcacttcgccagcaactaccaaaaaacacgcaaatctggaaagcgatttcggtc
aatactgaagcccaaagtacggtcgattttaccgatgatttgaatgtggatcgttatatt
tttgacagccagacagcgaaccaacaaggcggcacgggtaaaacctttgattggtcatta
attcccgaacatcttaagcacaagattattttagctggaggtatctcgccaaataatgta
gaacaagccattcaacaaaattgcttaggcttggatcttaattcaggagtagaaagttct
gtgggcgtaaaagatcaagaaaaagtacggttagtttttaataatatttattaa

DBGET integrated database retrieval system