KEGG   Haemophilus influenzae 86-028NP (nontypeable): NTHI1833Help
Entry
NTHI1833          CDS       T00248                                 

Gene name
tyrA
Definition
bifunctional chorismate mutase/prephenate dehydrogenase (EC:1.3.1.12 5.4.99.5)
Orthology
K14187  
chorismate mutase / prephenate dehydrogenase [EC:5.4.99.5 1.3.1.12]
Organism
hit  Haemophilus influenzae 86-028NP (nontypeable)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hit00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NTHI1833 (tyrA)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NTHI1833 (tyrA)
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    NTHI1833 (tyrA)
Enzymes [BR:hit01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.12  prephenate dehydrogenase
     NTHI1833 (tyrA)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     NTHI1833 (tyrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1687525..1688649)
Genome map
AA seq 374 aa AA seqDB search
MEVLKDLRSEIDSLDRELIQLFAKRLELVSQVGKVKHQHGLPIYAPEREIAMLQARRLEA
EKAGISADLIEDVLRRFMRESYANENQFGFKTINSDIHKIVIVGGYGKLGGLFARYLRAS
GYPISILDREDWAVAESILANADVVIVSVPINITLETIERLKPYLTENMLLADLTSVKRE
PLAKMLEVHSGAVLGLHPMFGADIASMAKQVVVRCDGRFPERYEWLLEQIQIWGAKIYQT
NATEHDHNMTYIQALRHFSTFANGLHLSKQPINLANLLALSSPIYRLELAMIGRLFAQDA
ELYADIIMDKPENLAVIETLKQTYDEALTFFEKNDRQGFIDAFHKVRDWFGDYSEQFLKE
SRQLLQQANDLKQG
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggaagtccttaaagatttacgttctgaaattgattcgcttgatcgcgaacttatccaa
ctttttgctaaacgtcttgagttggtttctcaagtcggtaaagtgaaacatcaacatgga
ttacctatttatgcgccagagcgtgaaatagcaatgctccaagcacgtcgtttagaggct
gaaaaagcaggcatttcagccgatttaattgaagatgttctacgccgttttatgcgtgaa
tcctatgccaatgaaaaccaatttggttttaaaactatcaattctgatattcacaaaatt
gttatcgtgggcggttatggtaaattaggtggcttatttgcccgttatttacgtgcatct
ggctatccaatttctattttagatcgcgaagattgggcggtggctgaaagtattttagcg
aatgctgatgtcgtgatcgtttccgtccccatcaatattactttggaaacgattgagcga
ctaaaaccttatttaacagaaaatatgttgcttgcagatttaacttctgttaagcgtgaa
ccgctagcgaaaatgcttgaagttcattctggtgcagttttaggtttacatccaatgttt
ggtgcagacattgcaagtatggcaaaacaagtggttgtacgttgtgatggacgttttcct
gaacgttatgaatggttacttgagcaaattcaaatttggggcgcaaaaatttatcaaacc
aatgccacagaacacgatcacaatatgacttatatacaagccttgcgccatttttcgact
tttgcgaatggtttacacctttccaaacagcccattaatctcgctaatttattggcgctt
tcttctcctatttatcgcttagaacttgcgatgatcggtcgcttatttgcgcaagatgca
gagctttacgcagatattattatggataagccagaaaatttagcggtaattgaaacgcta
aaacaaacttacgacgaagccttaactttctttgaaaagaatgatcgtcaaggttttatt
gatgctttccacaaggtgcgtgactggtttggcgattattctgaacaattcttaaaagaa
agccgtcagctattacagcaggcaaatgatttgaaacaagggtag

DBGET integrated database retrieval system