KEGG   Haemophilus influenzae 86-028NP (nontypeable): NTHI1833Help
Entry
NTHI1833          CDS       T00248                                 

Gene name
tyrA
Definition
bifunctional chorismate mutase/prephenate dehydrogenase (EC:1.3.1.12 5.4.99.5)
Orthology
K14187  
chorismate mutase / prephenate dehydrogenase [EC:5.4.99.5 1.3.1.12]
Organism
hit  Haemophilus influenzae 86-028NP (nontypeable)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hit01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:hit00400]
Metabolism; Biosynthesis of other secondary metabolites; Novobiocin biosynthesis [PATH:hit00401]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1687525..1688649)
Genome map
AA seq 374 aa AA seqDB search
MEVLKDLRSEIDSLDRELIQLFAKRLELVSQVGKVKHQHGLPIYAPEREIAMLQARRLEA
EKAGISADLIEDVLRRFMRESYANENQFGFKTINSDIHKIVIVGGYGKLGGLFARYLRAS
GYPISILDREDWAVAESILANADVVIVSVPINITLETIERLKPYLTENMLLADLTSVKRE
PLAKMLEVHSGAVLGLHPMFGADIASMAKQVVVRCDGRFPERYEWLLEQIQIWGAKIYQT
NATEHDHNMTYIQALRHFSTFANGLHLSKQPINLANLLALSSPIYRLELAMIGRLFAQDA
ELYADIIMDKPENLAVIETLKQTYDEALTFFEKNDRQGFIDAFHKVRDWFGDYSEQFLKE
SRQLLQQANDLKQG
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggaagtccttaaagatttacgttctgaaattgattcgcttgatcgcgaacttatccaa
ctttttgctaaacgtcttgagttggtttctcaagtcggtaaagtgaaacatcaacatgga
ttacctatttatgcgccagagcgtgaaatagcaatgctccaagcacgtcgtttagaggct
gaaaaagcaggcatttcagccgatttaattgaagatgttctacgccgttttatgcgtgaa
tcctatgccaatgaaaaccaatttggttttaaaactatcaattctgatattcacaaaatt
gttatcgtgggcggttatggtaaattaggtggcttatttgcccgttatttacgtgcatct
ggctatccaatttctattttagatcgcgaagattgggcggtggctgaaagtattttagcg
aatgctgatgtcgtgatcgtttccgtccccatcaatattactttggaaacgattgagcga
ctaaaaccttatttaacagaaaatatgttgcttgcagatttaacttctgttaagcgtgaa
ccgctagcgaaaatgcttgaagttcattctggtgcagttttaggtttacatccaatgttt
ggtgcagacattgcaagtatggcaaaacaagtggttgtacgttgtgatggacgttttcct
gaacgttatgaatggttacttgagcaaattcaaatttggggcgcaaaaatttatcaaacc
aatgccacagaacacgatcacaatatgacttatatacaagccttgcgccatttttcgact
tttgcgaatggtttacacctttccaaacagcccattaatctcgctaatttattggcgctt
tcttctcctatttatcgcttagaacttgcgatgatcggtcgcttatttgcgcaagatgca
gagctttacgcagatattattatggataagccagaaaatttagcggtaattgaaacgcta
aaacaaacttacgacgaagccttaactttctttgaaaagaatgatcgtcaaggttttatt
gatgctttccacaaggtgcgtgactggtttggcgattattctgaacaattcttaaaagaa
agccgtcagctattacagcaggcaaatgatttgaaacaagggtag

DBGET integrated database retrieval system