KEGG   Haemophilus influenzae 86-028NP (nontypeable): NTHI1934Help
Entry
NTHI1934          CDS       T00248                                 

Gene name
aceF
Definition
dihydrolipoamide acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hit  Haemophilus influenzae 86-028NP (nontypeable)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hit00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NTHI1934 (aceF)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NTHI1934 (aceF)
   00020 Citrate cycle (TCA cycle)
    NTHI1934 (aceF)
   00620 Pyruvate metabolism
    NTHI1934 (aceF)
Enzymes [BR:hit01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NTHI1934 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1780010..1781707
Genome map
AA seq 565 aa AA seqDB search
MSKQIQIPDIGSDEVTVTEVMVNVGDTISVDQSIINVEGDKASMEVPAPEAGVVKEILVK
VGDKVSTGTPMLVLEAAGAAPAADEPTAPVADAPTAPVVATAPTASAIVEVNVPDIGGDE
VNVTEIMVAVGDTITEEQSLISVEGDKASMEVPAPFGGVVKEILVKSGDKVSTGSLIMRF
EVLGAAPAASASASTSAPQTAAPATTAQAPQAAAPATTAQAPQAAAPDTTAQAAQSNNNV
SGLSQEQVEASTGYAHATPVIRRLAREFGVNLDKVKGTGRKGRIVKEDIEAYVKTAVKAY
ESGATAQATGNGVANGAGLGLLPWPKVDFSKFGEIEEVELSRINKISGANLHRNWVIIPH
VTHFDKADITDLEAFRKEQNALAEKQKLGVKITPVVFIMKAVAKALEAYPRFNSSITEDA
QRLILKKYINIGVAVDTPNGLVVPVFKNVNKKGIIELSRELMEVSKKAREGKLTASDMQG
GCFTISSLGGIGTTHFAPIVNAPEVAILGVSKSSMEPVWNGKEFAPRLILPMSLSFDHRV
IDGADGARFISYLGSVLADLRRLVM
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaacaaattcaaattcctgatattggtagtgatgaagttaccgtaacagaagtg
atggtaaacgtaggcgataccatttctgttgatcaatctatcattaacgttgaaggcgat
aaagcttcaatggaagtgcctgcaccagaagcgggtgttgtaaaagaaattttagtgaaa
gtgggcgataaagtttcaactggtactccaatgcttgtattagaagcggcaggtgctgct
ccagcagctgatgagcctactgctccagtagctgatgcgcctactgcaccagtggttgct
accgcaccaacggcttcagctattgtagaagtaaatgtgccagatattggtggcgatgaa
gtcaatgtaaccgaaattatggttgcagttggcgatacaatcactgaagaacaatcttta
attagcgttgaaggcgataaagcctcaatggaagttcctgcaccattcggcggtgtggta
aaagaaattttagtgaaatcaggcgataaagtttcaactggttcattaattatgcgtttt
gaagtactaggtgcagctccagcagcatcagcatcagcttcaacatcagcaccacagaca
gcagctcctgctactactgcacaagcaccacaggcagcagctcctgctactactgcacaa
gcaccacaggcagcagctcctgatactactgcacaagcagctcaatcaaataacaacgta
tctggattaagccaagaacaagtagaagcaagtacaggatatgcacacgcaacaccagtt
attcgtcgtttagctcgtgaatttggtgtaaatctagataaagtaaaaggtactggtcgt
aaaggtcgtatcgttaaagaagatattgaagcttatgtgaagaccgcagttaaagcttat
gaaagcggtgcaacagcacaagctactggcaatggtgtagcaaatggtgctggattaggc
ttattgccatggccaaaagttgatttcagtaaatttggcgaaattgaagaagttgaatta
agtcgtatcaacaaaatttcaggtgctaacttacatcgtaactgggtaataattccacac
gttactcacttcgataaagcagatatcacggatttagaagcattccgtaaagaacaaaat
gcgttagcagaaaaacaaaaactcggcgtaaaaatcacgccagttgtgttcattatgaaa
gcggtggcaaaagcattagaagcgtatccacgtttcaatagctcaattaccgaagatgct
caacgcttaatcctgaaaaaatatattaacatcggtgtcgcagtagatacgccgaatggc
ttagtcgtgcctgtattcaaaaatgtgaacaagaaaggcattatcgaactttcacgtgaa
ttaatggaagtatcgaaaaaagcacgtgaaggcaaattgactgcatctgatatgcaaggt
ggctgtttcaccatttcaagtcttggtggtattggtacaacgcactttgcgccaatcgta
aatgcgccagaagtagctatccttggtgtgtctaaatcatcaatggagccagtatggaac
ggtaaagaatttgcgccacgcttaattcttccaatgtcattatcattcgaccaccgtgtc
attgatggtgcagatggagctcgtttcattagctatcttggctctgttttagcagattta
cgtcgcttagtaatgtaa

DBGET integrated database retrieval system