KEGG   Haemophilus influenzae 86-028NP (nontypeable): NTHI1934Help
Entry
NTHI1934          CDS       T00248                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hit  Haemophilus influenzae 86-028NP (nontypeable)
Pathway
hit00010  Glycolysis / Gluconeogenesis
hit00020  Citrate cycle (TCA cycle)
hit00620  Pyruvate metabolism
hit01100  Metabolic pathways
hit01110  Biosynthesis of secondary metabolites
hit01120  Microbial metabolism in diverse environments
hit01130  Biosynthesis of antibiotics
hit01200  Carbon metabolism
Module
hit_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hit00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NTHI1934 (aceF)
   00020 Citrate cycle (TCA cycle)
    NTHI1934 (aceF)
   00620 Pyruvate metabolism
    NTHI1934 (aceF)
Enzymes [BR:hit01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NTHI1934 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 MSA-2c DEC-1_N
Motif
Other DBs
NCBI-ProteinID: AAX88687
UniProt: Q4QJW0
Position
1780010..1781707
Genome map
AA seq 565 aa AA seqDB search
MSKQIQIPDIGSDEVTVTEVMVNVGDTISVDQSIINVEGDKASMEVPAPEAGVVKEILVK
VGDKVSTGTPMLVLEAAGAAPAADEPTAPVADAPTAPVVATAPTASAIVEVNVPDIGGDE
VNVTEIMVAVGDTITEEQSLISVEGDKASMEVPAPFGGVVKEILVKSGDKVSTGSLIMRF
EVLGAAPAASASASTSAPQTAAPATTAQAPQAAAPATTAQAPQAAAPDTTAQAAQSNNNV
SGLSQEQVEASTGYAHATPVIRRLAREFGVNLDKVKGTGRKGRIVKEDIEAYVKTAVKAY
ESGATAQATGNGVANGAGLGLLPWPKVDFSKFGEIEEVELSRINKISGANLHRNWVIIPH
VTHFDKADITDLEAFRKEQNALAEKQKLGVKITPVVFIMKAVAKALEAYPRFNSSITEDA
QRLILKKYINIGVAVDTPNGLVVPVFKNVNKKGIIELSRELMEVSKKAREGKLTASDMQG
GCFTISSLGGIGTTHFAPIVNAPEVAILGVSKSSMEPVWNGKEFAPRLILPMSLSFDHRV
IDGADGARFISYLGSVLADLRRLVM
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaacaaattcaaattcctgatattggtagtgatgaagttaccgtaacagaagtg
atggtaaacgtaggcgataccatttctgttgatcaatctatcattaacgttgaaggcgat
aaagcttcaatggaagtgcctgcaccagaagcgggtgttgtaaaagaaattttagtgaaa
gtgggcgataaagtttcaactggtactccaatgcttgtattagaagcggcaggtgctgct
ccagcagctgatgagcctactgctccagtagctgatgcgcctactgcaccagtggttgct
accgcaccaacggcttcagctattgtagaagtaaatgtgccagatattggtggcgatgaa
gtcaatgtaaccgaaattatggttgcagttggcgatacaatcactgaagaacaatcttta
attagcgttgaaggcgataaagcctcaatggaagttcctgcaccattcggcggtgtggta
aaagaaattttagtgaaatcaggcgataaagtttcaactggttcattaattatgcgtttt
gaagtactaggtgcagctccagcagcatcagcatcagcttcaacatcagcaccacagaca
gcagctcctgctactactgcacaagcaccacaggcagcagctcctgctactactgcacaa
gcaccacaggcagcagctcctgatactactgcacaagcagctcaatcaaataacaacgta
tctggattaagccaagaacaagtagaagcaagtacaggatatgcacacgcaacaccagtt
attcgtcgtttagctcgtgaatttggtgtaaatctagataaagtaaaaggtactggtcgt
aaaggtcgtatcgttaaagaagatattgaagcttatgtgaagaccgcagttaaagcttat
gaaagcggtgcaacagcacaagctactggcaatggtgtagcaaatggtgctggattaggc
ttattgccatggccaaaagttgatttcagtaaatttggcgaaattgaagaagttgaatta
agtcgtatcaacaaaatttcaggtgctaacttacatcgtaactgggtaataattccacac
gttactcacttcgataaagcagatatcacggatttagaagcattccgtaaagaacaaaat
gcgttagcagaaaaacaaaaactcggcgtaaaaatcacgccagttgtgttcattatgaaa
gcggtggcaaaagcattagaagcgtatccacgtttcaatagctcaattaccgaagatgct
caacgcttaatcctgaaaaaatatattaacatcggtgtcgcagtagatacgccgaatggc
ttagtcgtgcctgtattcaaaaatgtgaacaagaaaggcattatcgaactttcacgtgaa
ttaatggaagtatcgaaaaaagcacgtgaaggcaaattgactgcatctgatatgcaaggt
ggctgtttcaccatttcaagtcttggtggtattggtacaacgcactttgcgccaatcgta
aatgcgccagaagtagctatccttggtgtgtctaaatcatcaatggagccagtatggaac
ggtaaagaatttgcgccacgcttaattcttccaatgtcattatcattcgaccaccgtgtc
attgatggtgcagatggagctcgtttcattagctatcttggctctgttttagcagattta
cgtcgcttagtaatgtaa

DBGET integrated database retrieval system