KEGG   Haemophilus influenzae 86-028NP (nontypeable): NTHI1963Help
Entry
NTHI1963          CDS       T00248                                 

Gene name
sucB
Definition
(RefSeq) dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
hit  Haemophilus influenzae 86-028NP (nontypeable)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hit00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NTHI1963 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NTHI1963 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    NTHI1963 (sucB)
Enzymes [BR:hit01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NTHI1963 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1809801..1811030)
Genome map
AA seq 409 aa AA seqDB search
MTIEILVPDLPESVADATVATWHKKLGDTVKRDEVIVEIETDKVVLEVPALSDGVLAEVV
QAEGETVVSKQLLGKISTAQEGDVSSATLKATNEPTPSDRQNAAIENSHNHNADQSPAIR
RLLAEHDLQADQIQGSGVGGRLTREDIEREIAKRQAQQVKQEAATEQNTISTVAYSARSE
KRVPMTRLRKRIAERLLEAKNSTAMLTTFNEVDMQPIMTLRKTYGEKFEKQYGVRLGFMS
FYIKAVVEALKRYPEVNASIDGDDVVYHNYFDISIAVSTPRGLVTPVLRDCDKLSMAEIE
KQIKALAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKERPI
ALNGQVVIHPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLLEI
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcgaaattcttgttccagacctacctgaatcagttgcagatgcaactgttgcc
acttggcataaaaaactgggcgatactgtgaaacgtgatgaggttattgtggaaattgaa
acggataaagtcgtgctagaagttcccgcactttctgatggtgtactggctgaagttgtt
caagctgagggcgaaacagtggtgagtaaacagttgctaggcaaaatttctacggctcaa
gaaggagatgtcagttcagcgacgttaaaagcaacgaatgaacccacaccatctgatcgt
caaaatgcagcgattgaaaatagtcataatcataatgcggatcagagccctgcaattcgt
cgtttattagcagaacatgatttacaagcagatcaaattcaaggttcgggtgtgggtggt
cgtttaacacgtgaagatattgaacgtgaaattgcaaaacgacaagcacagcaagtgaaa
caagaagctgccactgagcaaaatacaattagtacggtggcttatagcgcacgttctgaa
aaacgtgtgccaatgacccgtttgcgtaaacgtattgctgaacgtttacttgaagccaaa
aatagtacagcaatgcttactactttcaatgaagtggatatgcagccgataatgactttg
cgtaaaacctacggcgaaaaatttgaaaaacagtatggtgtccgtttaggctttatgtct
ttttatattaaagcggttgtggaagcattaaaacgttatcctgaagtgaatgcttctatt
gatggggatgatgttgtttaccataactattttgatattagtattgcagtttcaacacca
cgtggattagtcacaccagtgcttcgtgattgcgataagctcagtatggcagagatcgaa
aaacaaattaaagcattagctgaaaaaggtcgtgatggcaaattaacagtagaagatctt
actggcggcaattttactattacaaatggtggcgtgttcggttctcttatgtccactcca
attatcaatccaccacaaagtgcgattttaggaatgcacgctattaaagaacgcccgatt
gcgcttaatggtcaagttgtgattcatcctatgatgtaccttgctttatcttacgatcat
cgtttaattgacggccgtgaatctgttggtttcttggtaacgattaaagaattattggaa
gatccaacaagattgttattagaaatctaa

DBGET integrated database retrieval system