KEGG   Haemophilus influenzae 10810 (serotype b): HIB_00110Help
Entry
HIB_00110         CDS       T01720                                 

Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:hiu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HIB_00110
   00240 Pyrimidine metabolism
    HIB_00110
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    HIB_00110
   03430 Mismatch repair
    HIB_00110
   03440 Homologous recombination
    HIB_00110
Enzymes [BR:hiu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     HIB_00110
DNA replication proteins [BR:hiu03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     HIB_00110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(11850..12254)
Genome map
AA seq 134 aa AA seqDB search
MNRRDLLLQEIGISQWELYRPEVLQGSVGISVAENIRFITVSDENISSSPLLADVLLSLN
LKKENCLCLNYDQIQHMECKQPIRYWLLSENNDQIDRTLPFCKQAEQVYRSPSWQQFQSN
HQAKRALWQQIQQP
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgaacagacgcgatcttcttttacaagaaataggcatttcccagtgggaattatatcgc
cccgaggtactgcaaggttcagtaggaattagtgtggcagagaatattcgctttatcact
gtttccgatgaaaatatcagtagctcgcctttgttagctgatgtgctgttaagccttaat
cttaaaaaagaaaattgtttatgtttgaattacgatcaaatccagcatatggaatgtaag
cagcctattcgttactggttactatcagaaaataacgaccaaattgaccgcactttgcca
ttttgcaagcaggctgagcaggtttatcgctcgccaagttggcagcaatttcaatctaat
catcaagccaaacgagcgttgtggcaacaaattcagcagccttaa

DBGET integrated database retrieval system