KEGG   Haemophilus influenzae 10810 (serotype b): HIB_00110Help
Entry
HIB_00110         CDS       T01720                                 

Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:hiu00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:hiu00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:hiu03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:hiu03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hiu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(11850..12254)
Genome map
AA seq 134 aa AA seqDB search
MNRRDLLLQEIGISQWELYRPEVLQGSVGISVAENIRFITVSDENISSSPLLADVLLSLN
LKKENCLCLNYDQIQHMECKQPIRYWLLSENNDQIDRTLPFCKQAEQVYRSPSWQQFQSN
HQAKRALWQQIQQP
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgaacagacgcgatcttcttttacaagaaataggcatttcccagtgggaattatatcgc
cccgaggtactgcaaggttcagtaggaattagtgtggcagagaatattcgctttatcact
gtttccgatgaaaatatcagtagctcgcctttgttagctgatgtgctgttaagccttaat
cttaaaaaagaaaattgtttatgtttgaattacgatcaaatccagcatatggaatgtaag
cagcctattcgttactggttactatcagaaaataacgaccaaattgaccgcactttgcca
ttttgcaagcaggctgagcaggtttatcgctcgccaagttggcagcaatttcaatctaat
catcaagccaaacgagcgttgtggcaacaaattcagcagccttaa

DBGET integrated database retrieval system