KEGG   Haemophilus influenzae 10810 (serotype b): HIB_00570Help
Entry
HIB_00570         CDS       T01720                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihyropte ridin e pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hiu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HIB_00570
Enzymes [BR:hiu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     HIB_00570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
62704..63186
Genome map
AA seq 160 aa AA seqDB search
MITAYIALGSNLNTPIEQLHAALKAISQLSNTHLVTTSSFYKSKPLGPQDQPDYVNAVAK
IETELSPLKLLDELQRIENEQGRVRLRRWGERTLDLDILLYGNEIIQNERLTIPHYDMHN
REFVIVPLFEIASDLVLPNSQIITELVKQFADHKMIKLNP
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgattactgcatatattgctctaggtagcaatttaaacacaccaatagaacaattacat
gctgcgcttaaagcgataagtcagttatcaaacactcatttggtaacaacgagctctttt
tataaaagcaaaccgctcggcccacaagatcaacccgattatgtgaatgccgttgcaaaa
attgaaaccgaacttagtccgctcaagctattagatgaattacagcgtattgaaaacgag
caaggtcgagtgcgtttacgtcgctggggcgaacgcacgttagatttagatattttgctc
tacggcaatgaaattattcaaaacgaacgcttaacaattccccattatgatatgcataac
cgtgagtttgtcattgtgccgttgtttgaaatagcatcggatttagttttaccaaatagt
caaatcataacagagctggtcaagcaatttgctgaccacaaaatgataaaattaaatccc
tag

DBGET integrated database retrieval system