KEGG   Haemophilus influenzae 10810 (serotype b): HIB_01450Help
Entry
HIB_01450         CDS       T01720                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
hiu00260  Glycine, serine and threonine metabolism
hiu00750  Vitamin B6 metabolism
hiu01100  Metabolic pathways
hiu01110  Biosynthesis of secondary metabolites
hiu01120  Microbial metabolism in diverse environments
hiu01230  Biosynthesis of amino acids
Module
hiu_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hiu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HIB_01450
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HIB_01450
Enzymes [BR:hiu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HIB_01450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: CBW28336
UniProt: E1X922
Position
complement(143943..145220)
Genome map
AA seq 425 aa AA seqDB search
MNLYNIKHPEEQVTFSQAVRQGLGRDQGLFFPEVIPQLNNINELLELPVVERSQKILGAL
IDGELPQATLDAMVKNAFTFTAPLEKVEDNIYALELFHGPTLAFKDFGGRFMAQALAAVR
GDGKITILTATSGDTGAAVAHAFYGLENINVVILYPKGKISPLQEKLFCTLGGNIRTVAI
NADFDACQALVKQAFDDVELRQTIRLNSANSINISRLLAQVCYYFEAVAQLPKEKHDNVV
VSVPSGNFGNLTAGLIAKTLGLPIKRFVASTNANDTVPRYLKSGNWDPKTTVATLSNAMD
VSRPNNWPRVEELFKRNGWDLTDLGSGMLSDSETEDTLKAMQSKGYLCEPHGAIAYQVLK
DQLKASETGIFLCTAHPAKFKESVERILGIQLPLPETLDKHNQLPLLSDEMDNDFAQLRA
YLLKS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatacaatatcaaacacccagaagaacaagtcactttttctcaggctgttcgt
caaggtcttgggcgggatcaaggtctattctttccagaagttattcctcaacttaataac
attaatgaattacttgaattgcctgttgttgagcgtagtcaaaaaattctaggtgcatta
attgatggcgagttaccacaagcaacgttagatgcaatggtaaaaaatgcgtttactttc
actgcaccgttagaaaaagtggaagataatatttatgcacttgaattatttcacggtcca
acgctagcatttaaagattttggtgggcgttttatggcacaggcacttgctgcggtacgt
ggtgatggcaaaattactattttaacggcaacctcaggcgatactggagccgctgtagca
catgcgttttatggattagaaaatattaatgtagttatcctttatccaaaaggcaaaatc
agcccattgcaagaaaagctattctgtactttaggtgggaatattcgtactgttgctatt
aacgctgatttcgatgcgtgtcaggctttagttaaacaagcctttgatgatgttgaatta
cgccaaactatccgacttaactctgcaaattctattaatatcagccgtttattagctcaa
gtttgttattactttgaggctgtcgcacaattgccaaaagaaaaacatgataatgttgtg
gtttctgtgccaagtggtaattttggtaacttaacggcgggattaattgcaaaaacctta
ggcttgccgataaaacgctttgtcgcctcaacaaacgcaaatgatactgtgccacgttat
ttgaaatcgggtaattgggatcctaaaacgacagttgcaaccctttctaatgcaatggat
gtaagtcgcccaaacaattggccgagagtggaagaattgtttaaacgaaatggttgggat
ttaactgatttaggttcggggatgctaagtgatagcgaaacagaagataccttaaaagcg
atgcagtcgaaaggttatttatgtgaacctcacggtgcgatagcttatcaggtgttgaaa
gatcaacttaaagcgagtgaaacaggaatcttcctgtgtacggcacatcctgcgaaattt
aaagaatccgtagaacgtattcttggtattcagcttccattacctgaaacactggataaa
cataatcagctaccattgctttctgatgaaatggataatgattttgcacaactgcgggct
tacttattgaagtcataa

DBGET integrated database retrieval system