KEGG   Haemophilus influenzae 10810 (serotype b): HIB_01600Help
Entry
HIB_01600         CDS       T01720                                 

Definition
N-succinyl-diaminopimelate deacylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hiu01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:hiu00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(160047..161180)
Genome map
AA seq 377 aa AA seqDB search
MREKVVSLAQDLIRRPSISPNDEGCQQIIAERLEKLGFQIEWMPFNDTLNLWAKHGTSEP
VIAFAGHTDVVPTGDENQWSSPPFSAEIIDGMLYGRGAADMKGSLAAMIVAAEEYVKTNP
NHKGTIALLITSDEEAAAKDGTVRVVETLMARDEKITYCMVGEPSSAKNLGDVVKNGRRG
SITGNLYIQGIQGHVAYPHLAENPIHKAAPFLQELTTYQWDKGNEFFPPTSLQIANIHAG
TGSNNVIPAELYIQFNLRYCTEVTDEIIKQKVAEMLEKHNLKYRIEWNLSGKPFLTKPGK
LLDSITSAIEETIGITPKAETGGGTSDGRFIALMGAEVVEFGPLNSTIHKVNECVSVEDL
GKCGEIYHKMLVNLLDS
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgagagaaaaagtggtttcgttggcgcaagatttaattcgtcgcccatctattagcccg
aatgacgaaggctgtcagcaaattattgccgaacgtttagaaaagttaggttttcaaatt
gaatggatgccttttaatgacacgttgaatttgtgggcaaaacacggaacgagcgagcca
gttattgcgtttgcaggacatacggatgttgtgcctactggcgatgaaaatcaatggtcg
tctccgccgttttctgcggagattattgatggcatgctttatgggcgtggtgcggcggat
atgaaaggctcccttgcagcaatgattgtggcggcagaagaatacgtaaaaacaaatcct
aaccataaaggcaccattgcattattgattacctctgacgaagaggcagccgcaaaagac
ggcaccgtgcgtgtggttgagactttaatggcacgtgatgaaaaaattacttattgtatg
gttggcgagccatcgagtgctaaaaacttaggcgatgttgtcaaaaatggtcgccgcggc
tcaattacaggaaatctctatattcaaggtattcaaggacacgtagcctatccgcattta
gctgaaaatccaatccataaagcagcgccattcttgcaagaattaacgacttaccaatgg
gataaaggcaatgaatttttcccgccaacaagcctacaaattgctaacattcacgcgggt
acgggaagtaataatgtaattcctgctgagttatatattcagttcaatttgcgttattgc
acagaagtcacggatgaaatcattaagcaaaaagtggctgaaatgttagaaaaacacaat
ttgaagtatcgtattgaatggaatttatcaggcaaaccctttttaacaaaaccaggtaaa
ttattagattcgataacctccgctattgaggaaaccataggcataacgccaaaggctgaa
acaggtggcggcacgtcagacggtcgttttattgcattgatgggcgcagaagtagtggaa
tttggcccgttaaattcaactattcataaagtcaatgaatgtgtcagtgtagaagacctt
ggcaagtgcggtgaaatttaccacaaaatgttagtgaatttattggatagctaa

DBGET integrated database retrieval system