KEGG   Haemophilus influenzae 10810 (serotype b): HIB_03640Help
Entry
HIB_03640         CDS       T01720                                 

Definition
DLP12 prophage lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Brite
Enzymes [BR:hiu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     HIB_03640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(384376..384918)
Genome map
AA seq 180 aa AA seqDB search
MILTKTRKALGVCSVITVMGLMYAQFGGELRLSPVGAEIIGNAEGCRRDPYQCPADVLTV
GIGSTEYGGKKINPKHRYTDLEIAERWKNDIVIAERCVNKYGNGEVLPQSVFDSAVSITF
NVGCGAVSKSTMFKYLRAKQYEKACGEFPRWVYASGKKLAGLVVRREKEKALCLADLKLP
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgattttgacaaaaactaggaaagctcttggtgtttgctctgtgattacggtaatggga
ttaatgtatgctcagttcggtggcgagctaagattaagtcctgtaggtgctgaaattatt
gggaatgccgagggttgcagacgtgatccgtatcaatgccctgcggatgttttgaccgta
ggaattggttcaactgaatatggtggtaagaaaatcaatccaaaacaccgttacacagat
ttggaaattgccgaacgttggaagaatgatattgtgattgctgaacgatgtgtgaacaaa
tatggcaatggcgaggtgttaccgcaatcggtatttgattctgcggtgtcaatcactttt
aatgtgggttgtggggcagtaagcaaatctacgatgtttaaatatcttcgagcaaaacaa
tatgaaaaggcttgtggcgaatttcctagatgggtgtatgccagtggtaaaaaattagca
ggtttggtggttcgccgagaaaaagagaaagcattatgtttagccgatttgaaactgcca
taa

DBGET integrated database retrieval system