KEGG   Haemophilus influenzae 10810 (serotype b): HIB_05520Help
Entry
HIB_05520         CDS       T01720                                 

Definition
gap repair protein
Orthology
K06187  
recombination protein RecR
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hiu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HIB_05520
DNA repair and recombination proteins [BR:hiu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      HIB_05520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
558685..559287
Genome map
AA seq 200 aa AA seqDB search
MQSSPLLEHLIENLRCLPGVGPKSAQRMAYHLLQRNRSGGMNLARALTEAMSKIGHCSQC
RDFTEEDTCNICNNPRRQNSGLLCVVEMPADIQAIEQTGQFSGRYFVLMGHLSPLDGIGP
REIGLDLLQKRLVEESFHEVILATNPTVEGDATANYIAEMCRQHNIKVSRIAHGIPVGGE
LETVDGTTLTHSFLGRRQID
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagcagcccacttttagaacaccttattgaaaacttacgttgtcttccaggcgta
gggcctaaatctgcgcaacgtatggcttatcatcttttacagcgtaatcgtagcggtgga
atgaatttagctcgagcactcacagaagctatgtctaaaattggtcattgttcacaatgt
cgagactttacggaagaagacacttgcaacatttgcaataatccacgccgtcaaaattca
ggtttgctttgtgtcgttgaaatgccagctgatattcaagcgattgagcaaacggggcaa
ttttcaggacgttattttgttttaatgggacatttgtctccacttgatggtattggacct
cgtgaaattggcttagatttactgcaaaaacgcttagtagaagaatctttccacgaagtg
attcttgcaacaaatccaacggtggaaggcgatgctacagcaaactacattgctgaaatg
tgccgccaacacaatattaaagtgagtcgtatcgctcacggtatccctgtcggtggtgaa
ctggaaactgtggacggcacaacgcttactcactcttttctaggtcgtcgtcaaatcgac
taa

DBGET integrated database retrieval system