KEGG   Haemophilus influenzae 10810 (serotype b): HIB_05990Help
Entry
HIB_05990         CDS       T01720                                 

Definition
bifunctional histidinal dehydrogenase/histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hiu01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:hiu00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
601288..602571
Genome map
AA seq 427 aa AA seqDB search
MQTIIWNHLSETEKRKVIMRPVQQNGKNIQQAVNAIRENVAYNGDRALFELCEKFDGVKL
DKLIVSVDEIQAASSRISVKLRNAIEQAKTNIEAFHKAQQNQEIDLEIQEGVRCQVVTRP
ISCVGLYIPGGSAPLFSTVLMLAIPAKIAGCKKIVLCSPPPISDEILYTAHLCGVETIYA
IGGAQAVFAMAQGTESVAKVDKIFGPGNAFVTEAKRQVAQNSTAIDMPAGPSEVLVIADE
SADPEFVASDLLSQAEHGADSQVILVATCQTLAKETALATERQLALLPRAETVRKALNHS
RIFIAESLEQAVEISNEYAPEHLIVQTKNARKLLPYLDNAGSIFLGAYSPESMGDYASGT
NHVLPTYGYTKTYSSLGLADFSKRMTVQELTPKGFKNLAETVEVMAEAEQLAAHKMAVSV
RLAKLNI
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacaattatttggaatcatttatcagaaactgaaaaacgcaaagtcattatgcgt
ccagtccaacaaaatgggaaaaacattcagcaggcagttaatgccattcgtgaaaatgtg
gcatacaatggcgatcgggcgttatttgaactctgtgaaaaatttgatggcgtgaagtta
gataaactcattgtttcggtagatgaaattcaagcggcaagtagtcggatttctgtaaaa
cttcgcaatgcgattgagcaagccaaaacgaacattgaagcctttcacaaagcacagcaa
aatcaggaaattgacctagagatccaagaaggcgtgcgttgccaagttgtgactcgtcca
atttcttgtgtagggctttatattccaggtggttcagctccgctgttttccaccgtattg
atgttagctattcctgctaaaattgcaggttgtaaaaaaatcgtgctttgttcaccgcca
ccgatctcagatgaaattctctacactgctcatctttgcggtgtggaaactatctacgct
ataggtggtgctcaagcagtttttgcgatggctcaaggcacggaaagtgtggcgaaagta
gataaaattttcggacctggaaacgcatttgtgacagaagcaaaacgtcaggtagcacaa
aatagtacggcgattgatatgccagcgggaccttcagaagtgttagtaattgcagatgaa
tcggcagatcctgaatttgtggcaagcgatttactctctcaagcggaacatggggcagat
agccaagtgattttggtggcgacctgtcaaactctggcaaaagagaccgcacttgcgact
gaacgccaacttgctctattacctcgtgctgaaaccgttcgaaaagcgttaaaccacagc
cgtatttttatagcagaaagccttgaacaagcggtagaaattagcaatgaatatgcccct
gaacatttaattgtgcaaacaaaaaacgcccgtaaattattaccatatttagataacgca
ggctcaattttcttaggtgcatattcgcctgaaagtatgggcgattatgccagtggcaca
aaccacgttttgcctacttatggttacaccaaaacttattctagtctaggattagctgat
tttagtaagcgaatgacagtacaagaactcacaccaaaaggttttaaaaaccttgctgaa
acggtggaagtgatggcagaagctgagcaattggcagcacataaaatggcagtaagtgta
agattggcgaaactcaatatctaa

DBGET integrated database retrieval system