KEGG   Haemophilus influenzae 10810 (serotype b): HIB_06310Help
Entry
HIB_06310         CDS       T01720                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:hiu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HIB_06310
Enzymes [BR:hiu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     HIB_06310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
631573..632493
Genome map
AA seq 306 aa AA seqDB search
MRKTLTILGSINADHVISVPYFAKPGETLTGQNYQIAYGGKGANQAVAAARLGAKVAFIS
CIGSDSIGKTMKNAFAQEGIDTTHINTVSQEMTGMAFIQVAQSGENSIVLTSGANSHLNE
IVVRQSEAQIAQSDCLLMQLETPLSGVELAAQIAKKNGVKVVLNPAPAQILSDELLSLID
IITPNETEAEILTGIAVTDEQSAVKAASVFHDKGIETVMITLGAKGVFVSRKGKSRIIKG
FCVQAIDTTAAGDTFNGGFVTALLEEKSFDEAIRFGQAAAAISVTKKGAQSSIPTRQETL
KFLEHA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaccctcacaattctcggtagtatcaatgctgatcacgttatttctgtgcct
tactttgctaaacccggtgaaacgctaacaggtcaaaattatcaaattgcctatggtggc
aaaggtgccaatcaagcagtggcagccgctcgtttaggggcaaaggtcgcgttcattagt
tgcattggatcagatagcataggcaaaacaatgaaaaatgcgtttgcacaagaaggaatt
gatacaacccatattaataccgtttcacaggaaatgacgggaatggcatttattcaagtt
gcccaatcgggcgagaacagtattgtgctgactagcggtgcaaattcacatttgaatgag
atagttgttcgtcaaagtgaggcgcaaattgcacaatcggattgcttgttaatgcaatta
gaaaccccactttctggtgtggagctggctgctcaaatcgctaagaaaaatggtgtcaag
gttgtgctaaatcctgctccagcgcagattttatcggacgaattattgagtttgattgat
attattacaccaaatgaaactgaagctgaaatcctgacggggatagcggtaaccgacgag
caaagtgcggtgaaagctgcgagtgtttttcacgataaaggtattgaaaccgtgatgatt
acccttggcgcgaaaggcgtgtttgtcagtcgaaaaggtaaaagccgcatcattaagggc
ttttgtgtgcaagcaatagatactaccgcagctggtgatacatttaatggcggttttgtt
acggctttattggaagaaaaatcctttgatgaagccattcgttttgggcaagctgctgct
gcgattagtgtgacgaaaaaaggggcgcaatcctctattccaacgcgtcaagaaactttg
aaatttcttgaacacgcttaa

DBGET integrated database retrieval system